Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DAPK1 Gene

Aliases for DAPK1 Gene

  • Death Associated Protein Kinase 1 2 3 5
  • Death-Associated Protein Kinase 1 2 3
  • DAP Kinase 1 3 4
  • EC 2.7.11.1 4 56
  • DAPK 3 4
  • EC 2.7.11 56
  • ROCO3 3

External Ids for DAPK1 Gene

Previous GeneCards Identifiers for DAPK1 Gene

  • GC09P081156
  • GC09P081966
  • GC09P083667
  • GC09P085569
  • GC09P087342
  • GC09P089301
  • GC09P090112
  • GC09P059938

Summaries for DAPK1 Gene

Entrez Gene Summary for DAPK1 Gene

  • Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

GeneCards Summary for DAPK1 Gene

DAPK1 (Death Associated Protein Kinase 1) is a Protein Coding gene. Diseases associated with DAPK1 include Pediatric Lymphoma and Bladder Cancer. Among its related pathways are Regulation by c-FLIP and CDK-mediated phosphorylation and removal of Cdc6. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is DAPK3.

UniProtKB/Swiss-Prot for DAPK1 Gene

  • Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.

  • Isoform 2 cannot induce apoptosis but can induce membrane blebbing.

Tocris Summary for DAPK1 Gene

Gene Wiki entry for DAPK1 Gene

Additional gene information for DAPK1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DAPK1 Gene

Genomics for DAPK1 Gene

GeneHancer (GH) Regulatory Elements for DAPK1 Gene

Promoters and enhancers for DAPK1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH09I087497 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 561.8 +2.0 2009 4.3 HDGF FOXA2 ARID4B SIN3A DMAP1 ZNF48 YY1 GLIS2 ZNF213 ZNF143 DAPK1 RPS29P18
GH09I087494 Enhancer 1 FANTOM5 ENCODE 563.6 -1.9 -1865 1.7 HDAC1 PKNOX1 FEZF1 ZNF335 EGR1 ATF7 FOS IKZF2 RUNX3 EGR2 DAPK1 CTSL GC09M087454
GH09I087554 Enhancer 1.3 FANTOM5 Ensembl ENCODE dbSUPER 27 +58.5 58485 3.4 HDAC1 RFX1 L3MBTL2 SOX6 NR2F1 CEBPB EBF1 ZEB2 CEBPG KLF5 DAPK1 CTSL DAPK1-IT1 GC09P087601
GH09I087568 Enhancer 1.3 Ensembl ENCODE dbSUPER 22.6 +73.3 73319 4.4 CLOCK FOXA2 MLX ZFP64 ARID4B FEZF1 DMAP1 ZNF48 ETS1 YY1 DAPK1 DAPK1-IT1 GC09P087601
GH09I087518 Enhancer 1.3 Ensembl ENCODE dbSUPER 20.4 +22.4 22356 2.5 PKNOX1 ATF1 ARNT NCOA2 TCF12 ZNF766 GATA2 ATF7 NCOA1 ZNF592 DAPK1 RPS29P18
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around DAPK1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the DAPK1 gene promoter:

Genomic Locations for DAPK1 Gene

Genomic Locations for DAPK1 Gene
chr9:87,497,228-87,708,634
(GRCh38/hg38)
Size:
211,407 bases
Orientation:
Plus strand
chr9:90,112,143-90,323,549
(GRCh37/hg19)

Genomic View for DAPK1 Gene

Genes around DAPK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DAPK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DAPK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DAPK1 Gene

Proteins for DAPK1 Gene

  • Protein details for DAPK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P53355-DAPK1_HUMAN
    Recommended name:
    Death-associated protein kinase 1
    Protein Accession:
    P53355
    Secondary Accessions:
    • B7ZLD2
    • B7ZLE7
    • Q14CQ7
    • Q1W5W0
    • Q68CP8
    • Q6ZRZ3
    • Q9BTL8

    Protein attributes for DAPK1 Gene

    Size:
    1430 amino acids
    Molecular mass:
    160046 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with KLHL20. Interacts (via death domain) with MAPK1 and MAPK3. Interacts with MAP1B (via N-terminus). Interacts (via death domain) with UNC5B (via death domain). Interacts with PRKD1 in an oxidative stress-regulated manner. Interacts with PIN1, PDCD6, BECN1, GRINB, TSC2 and STX1A. Interacts (via kinase domain) with DAPK3 (via kinase domain).
    SequenceCaution:
    • Sequence=AAP35581.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Sequence of unknown origin in the C-terminal part.; Evidence={ECO:0000305}; Sequence=CAA53712.1; Type=Frameshift; Positions=462, 464; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for DAPK1 Gene

    Alternative splice isoforms for DAPK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DAPK1 Gene

Selected DME Specific Peptides for DAPK1 Gene

P53355:
  • GVITYILL
  • EFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILL
  • IRRLLVKD
  • GGELFDFLAEKESLTE
  • GDTKQET
  • GEELGSGQFA
  • GTPEFVAPE
  • IAHFDLKPENIMLLD
  • IIDFGLA

Post-translational modifications for DAPK1 Gene

  • In response to mitogenic stimulation (PMA or EGF), phosphorylated at Ser-289; phosphorylation suppresses DAPK1 pro-apoptotic function. Autophosphorylation at Ser-308 inhibits its catalytic activity. Phosphorylation at Ser-734 by MAPK1 increases its catalytic activity and promotes cytoplasmic retention of MAPK1. Endoplasmic-stress can cause dephosphorylation at Ser-308.
  • Removal of the C-terminal tail of isoform 2 (corresponding to amino acids 296-337 of isoform 2) by proteolytic cleavage stimulates maximally its membrane-blebbing function.
  • Ubiquitinated by the BCR(KLHL20) E3 ubiquitin ligase complex, leading to its degradation by the proteasome.

Domains & Families for DAPK1 Gene

Suggested Antigen Peptide Sequences for DAPK1 Gene

Graphical View of Domain Structure for InterPro Entry

P53355

UniProtKB/Swiss-Prot:

DAPK1_HUMAN :
  • The autoinhibitory domain sterically blocks the substrate peptide-binding site by making both hydrophobic and electrostatic contacts with the kinase core.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
Domain:
  • The autoinhibitory domain sterically blocks the substrate peptide-binding site by making both hydrophobic and electrostatic contacts with the kinase core.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
genes like me logo Genes that share domains with DAPK1: view

Function for DAPK1 Gene

Molecular function for DAPK1 Gene

GENATLAS Biochemistry:
DAP kinase,160kDa,coupling the control of apoptosis to metastasis,triggered by IFNG,localized to the actin microfilament network
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by Ca(2+)/calmodulin. Regulated by a locking mechanism, involving autophosphorylation at Ser-308 and calmodulin binding. In the inactive state, Ser-308 is phosphorylated. Activation involves its dephosphorylation and a release-of-autoinhibition mechanism where binding of calmodulin induces a conformational change that relieves the steric block of the active site by the autoinhibitory domain. Activity is modulated by UNC5B and NTN1. UNC5B activates it by inhibiting the phosphorylation at Ser-308, whereas NTN1 inhibits UNC5B-mediated activation of DAPK1. Endoplasmic-stress activates by causing Ser-308 dephosphorylation.
UniProtKB/Swiss-Prot Function:
Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.
UniProtKB/Swiss-Prot Function:
Isoform 2 cannot induce apoptosis but can induce membrane blebbing.
UniProtKB/Swiss-Prot Induction:
Up-regulated following treatment with IFNG/IFN-gamma.

Enzyme Numbers (IUBMB) for DAPK1 Gene

Phenotypes From GWAS Catalog for DAPK1 Gene

Gene Ontology (GO) - Molecular Function for DAPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IDA 7828849
GO:0004674 protein serine/threonine kinase activity TAS 16756490
GO:0004683 calmodulin-dependent protein kinase activity IDA 10629061
GO:0005515 protein binding IPI 15616583
GO:0005516 calmodulin binding IDA,IEA 10629061
genes like me logo Genes that share ontologies with DAPK1: view
genes like me logo Genes that share phenotypes with DAPK1: view

Animal Models for DAPK1 Gene

MGI Knock Outs for DAPK1:

Animal Model Products

Clone Products

  • Addgene plasmids for DAPK1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DAPK1 Gene

Localization for DAPK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DAPK1 Gene

Isoform 1: Cytoplasm. Cytoplasm, cytoskeleton. Note=Colocalizes with MAP1B in the microtubules and cortical actin fibers.
Isoform 2: Cytoplasm. Cytoplasm, cytoskeleton.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DAPK1 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
cytosol 4
nucleus 2
extracellular 1
mitochondrion 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for DAPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IDA,IEA 12730201
GO:0005856 cytoskeleton IEA --
GO:0005886 plasma membrane IDA 12730201
GO:0015629 actin cytoskeleton IDA 10629061
genes like me logo Genes that share ontologies with DAPK1: view

Pathways & Interactions for DAPK1 Gene

genes like me logo Genes that share pathways with DAPK1: view

Pathways by source for DAPK1 Gene

2 Sino Biological pathways for DAPK1 Gene
1 Cell Signaling Technology pathway for DAPK1 Gene
2 BioSystems pathways for DAPK1 Gene

SIGNOR curated interactions for DAPK1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for DAPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006417 regulation of translation IEA --
GO:0006468 protein phosphorylation TAS 16756490
GO:0006915 apoptotic process IGI,IMP 10629061
GO:0007165 signal transduction IEA --
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors IEA --
genes like me logo Genes that share ontologies with DAPK1: view

Drugs & Compounds for DAPK1 Gene

(12) Drugs for DAPK1 Gene - From: DrugBank, PharmGKB, ApexBio, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
calcium Approved Nutra 0
Gemcitabine Approved Pharma Ribonucleotide reductase and DNA synthesis inhibitor, Nucleoside Analogs 2100
Magnesium Approved Nutra 0
5,6-Dihydro-Benzo[H]Cinnolin-3-Ylamine Experimental Pharma Target 0
6-(3-AMINOPROPYL)-4,9-DIMETHYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE Experimental Pharma Target 0

(6) Additional Compounds for DAPK1 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(2) Tocris Compounds for DAPK1 Gene

Compound Action Cas Number
DAPK Substrate Peptide Death associated protein kinase substrate (synthetic) 386769-53-5
TC-DAPK 6 Potent and selective inhibitor of DAPK1

(2) ApexBio Compounds for DAPK1 Gene

Compound Action Cas Number
DAPK Substrate Peptide Synthetic peptide substrate for DAPK 386769-53-5
TC-DAPK 6 DAPK inhibitor 315694-89-4
genes like me logo Genes that share compounds with DAPK1: view

Drug Products

Transcripts for DAPK1 Gene

Clone Products

  • Addgene plasmids for DAPK1

Alternative Splicing Database (ASD) splice patterns (SP) for DAPK1 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^
SP1: - - - -
SP2:
SP3: - -
SP4:
SP5: - -
SP6: - - - -
SP7:
SP8: -

ExUns: 22a · 22b ^ 23 ^ 24 ^ 25 ^ 26a · 26b ^ 27a · 27b ^ 28 ^ 29
SP1: - - -
SP2:
SP3:
SP4: - -
SP5:
SP6:
SP7:
SP8:

Relevant External Links for DAPK1 Gene

GeneLoc Exon Structure for
DAPK1
ECgene alternative splicing isoforms for
DAPK1

Expression for DAPK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DAPK1 Gene

Protein differential expression in normal tissues from HIPED for DAPK1 Gene

This gene is overexpressed in Placenta (46.6) and Fetal Brain (11.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DAPK1 Gene



Protein tissue co-expression partners for DAPK1 Gene

NURSA nuclear receptor signaling pathways regulating expression of DAPK1 Gene:

DAPK1

SOURCE GeneReport for Unigene cluster for DAPK1 Gene:

Hs.380277

mRNA Expression by UniProt/SwissProt for DAPK1 Gene:

P53355-DAPK1_HUMAN
Tissue specificity: Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas.

Evidence on tissue expression from TISSUES for DAPK1 Gene

  • Nervous system(4.7)
  • Liver(4.3)
  • Lung(2.5)
  • Stomach(2)
genes like me logo Genes that share expression patterns with DAPK1: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for DAPK1 Gene

Orthologs for DAPK1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for DAPK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DAPK1 33 34
  • 99.21 (n)
oppossum
(Monodelphis domestica)
Mammalia DAPK1 34
  • 94 (a)
OneToOne
cow
(Bos Taurus)
Mammalia DAPK1 33 34
  • 90.77 (n)
dog
(Canis familiaris)
Mammalia DAPK1 33 34
  • 89.77 (n)
mouse
(Mus musculus)
Mammalia Dapk1 33 16 34
  • 87.67 (n)
rat
(Rattus norvegicus)
Mammalia Dapk1 33
  • 87.6 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia DAPK1 34
  • 63 (a)
OneToOne
chicken
(Gallus gallus)
Aves DAPK1 33 34
  • 78.55 (n)
lizard
(Anolis carolinensis)
Reptilia DAPK1 34
  • 89 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dapk1 33
  • 74.7 (n)
zebrafish
(Danio rerio)
Actinopterygii dapk1 33 34
  • 68.86 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG1776 35
  • 43 (a)
worm
(Caenorhabditis elegans)
Secernentea dapk-1 33 34
  • 46.21 (n)
ZC373.4 35
  • 38 (a)
K12C11.4 35
  • 34 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes MBP1 36
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 46 (a)
OneToMany
Species where no ortholog for DAPK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DAPK1 Gene

ENSEMBL:
Gene Tree for DAPK1 (if available)
TreeFam:
Gene Tree for DAPK1 (if available)

Paralogs for DAPK1 Gene

Paralogs for DAPK1 Gene

Pseudogenes.org Pseudogenes for DAPK1 Gene

genes like me logo Genes that share paralogs with DAPK1: view

Variants for DAPK1 Gene

Sequence variations from dbSNP and Humsavar for DAPK1 Gene

SNP ID Clin Chr 09 pos Variation AA Info Type
rs1000007182 -- 87,616,223(+) C/G genic_upstream_transcript_variant, intron_variant
rs1000011535 -- 87,531,022(+) T/C genic_upstream_transcript_variant, intron_variant
rs1000047119 -- 87,581,928(+) C/T genic_upstream_transcript_variant, intron_variant
rs1000048990 -- 87,512,184(+) C/A genic_upstream_transcript_variant, intron_variant
rs1000061099 -- 87,630,486(+) G/T genic_upstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for DAPK1 Gene

Variant ID Type Subtype PubMed ID
nsv972772 CNV duplication 23825009
nsv957764 CNV deletion 24416366
nsv8545 CNV gain 18304495
nsv478259 CNV novel sequence insertion 20440878
nsv474751 CNV novel sequence insertion 20440878
nsv1161882 CNV duplication 26073780
nsv1161881 CNV duplication 26073780
nsv1147663 CNV duplication 26484159
nsv1077558 CNV duplication 25765185
nsv1053574 CNV gain 25217958
esv3620983 CNV loss 21293372
esv3620981 CNV loss 21293372
esv3342753 CNV duplication 20981092
esv28714 CNV loss 19812545
esv2759703 CNV loss 17122850
esv2738709 CNV deletion 23290073
esv2738708 CNV deletion 23290073
esv22121 CNV gain 19812545
esv21629 CNV loss 19812545
esv1463209 CNV deletion 17803354
esv1345777 CNV deletion 17803354
esv1024641 CNV deletion 17803354
esv1009206 CNV deletion 20482838

Variation tolerance for DAPK1 Gene

Residual Variation Intolerance Score: 2.22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.52; 71.94% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for DAPK1 Gene

Human Gene Mutation Database (HGMD)
DAPK1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DAPK1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DAPK1 Gene

Disorders for DAPK1 Gene

MalaCards: The human disease database

(16) MalaCards diseases for DAPK1 Gene - From: HGMD, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
pediatric lymphoma
  • childhood lymphoma
bladder cancer
  • bladder cancer, somatic
cervical squamous cell carcinoma
  • squamous cell carcinoma of cervix
cervical cancer
  • cervical cancer, somatic
cholecystitis
  • acute and chronic cholecystitis
- elite association - COSMIC cancer census association via MalaCards
Search DAPK1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for DAPK1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with DAPK1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DAPK1 Gene

Publications for DAPK1 Gene

  1. The Cullin 3 substrate adaptor KLHL20 mediates DAPK ubiquitination to control interferon responses. (PMID: 20389280) Lee YR … Chen RH (The EMBO journal 2010) 3 4 22 58
  2. DAP-kinase-mediated phosphorylation on the BH3 domain of beclin 1 promotes dissociation of beclin 1 from Bcl-XL and induction of autophagy. (PMID: 19180116) Zalckvar E … Kimchi A (EMBO reports 2009) 3 4 22 58
  3. An alternative transcript from the death-associated protein kinase 1 locus encoding a small protein selectively mediates membrane blebbing. (PMID: 18422656) Lin Y … Hupp T (The FEBS journal 2008) 3 4 22 58
  4. Control of death-associated protein kinase (DAPK) activity by phosphorylation and proteasomal degradation. (PMID: 17056602) Jin Y … Gallagher PJ (The Journal of biological chemistry 2006) 3 4 22 58
  5. The tumor suppressor DAP kinase is a target of RSK-mediated survival signaling. (PMID: 16213824) Anjum R … Blenis J (Current biology : CB 2005) 3 4 22 58

Products for DAPK1 Gene

Sources for DAPK1 Gene

Content
Loading form....