This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 25% of commonly prescribed drugs. Its substrates incl... See more...

Aliases for CYP2D6 Gene

Aliases for CYP2D6 Gene

  • Cytochrome P450 Family 2 Subfamily D Member 6 2 3 5
  • Cytochrome P450, Subfamily IID (Debrisoquine, Sparteine, Etc., -Metabolising), Polypeptide 8 Pseudogene 2 2 3
  • Cytochrome P450, Subfamily II (Debrisoquine, Sparteine, Etc., -Metabolising), Polypeptide 7 Pseudogene 2 2 3
  • Cytochrome P450, Subfamily IID (Debrisoquine, Sparteine, Etc., -Metabolizing), Polypeptide 6 2 3
  • Cytochrome P450, Family 2, Subfamily D, Polypeptide 7 Pseudogene 2 2 3
  • Cytochrome P450, Family 2, Subfamily D, Polypeptide 8 Pseudogene 2 2 3
  • Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 2 3
  • Cholesterol 25-Hydroxylase 3 4
  • Debrisoquine 4-Hydroxylase 3 4
  • Cytochrome P450 2D6 3 4
  • Cytochrome P450-DB1 3 4
  • CYP2DL1 3 4
  • CYPIID6 3 4
  • Cytochrome P450, Subfamily IID (Debrisoquine, Sparteine, Etc., -Metabolizing)-Like 1 3
  • Flavoprotein-Linked Monooxygenase 3
  • Nonfunctional Cytochrome P450 2D6 3
  • Microsomal Monooxygenase 3
  • Xenobiotic Monooxygenase 3
  • EC 1.14.14.1 52
  • EC 1.14.14.- 4
  • P450-DB1 3
  • CYP2D7AP 3
  • CYP2D7BP 3
  • CYP2D7P2 3
  • CYP2D8P2 3
  • P450C2D 3
  • P450DB1 3
  • CYP2D 3
  • CPD6 3

External Ids for CYP2D6 Gene

Previous HGNC Symbols for CYP2D6 Gene

  • CYP2DL1
  • CYP2D7P2
  • CYP2D7BP
  • CYP2D8P2
  • CYP2D7AP

Previous GeneCards Identifiers for CYP2D6 Gene

  • GC22U990011
  • GC22M039139
  • GC22M040766
  • GC22M040768
  • GC22M040769
  • GC22M040848
  • GC22M040849
  • GC22M040852
  • GC22M042522
  • GC22M025488
  • GC22M042126
  • GC22M042802
  • GC22M042916
  • GC22M042981
  • GC22M042131
  • GC22M042297
  • GC22M042350
  • GC22M042688

Summaries for CYP2D6 Gene

Entrez Gene Summary for CYP2D6 Gene

  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 25% of commonly prescribed drugs. Its substrates include antidepressants, antipsychotics, analgesics and antitussives, beta adrenergic blocking agents, antiarrythmics and antiemetics. The gene is highly polymorphic in the human population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. Some individuals with the poor metabolizer phenotype have no functional protein since they carry 2 null alleles whereas in other individuals the gene is absent. This gene can vary in copy number and individuals with the ultrarapid metabolizer phenotype can have 3 or more active copies of the gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

CIViC Summary for CYP2D6 Gene

GeneCards Summary for CYP2D6 Gene

CYP2D6 (Cytochrome P450 Family 2 Subfamily D Member 6) is a Protein Coding gene. Diseases associated with CYP2D6 include Drug Metabolism, Poor, Cyp2d6-Related and Codeine Toxicity. Among its related pathways are Imipramine/Desipramine Pathway, Pharmacokinetics and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and heme binding. An important paralog of this gene is CYP2D7.

UniProtKB/Swiss-Prot Summary for CYP2D6 Gene

  • A cytochrome P450 monooxygenase involved in the metabolism of fatty acids, steroids and retinoids (PubMed:18698000, PubMed:19965576, PubMed:20972997, PubMed:21289075, PubMed:21576599). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed:18698000, PubMed:19965576, PubMed:20972997, PubMed:21289075, PubMed:21576599). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) (PubMed:19965576, PubMed:20972997). Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 20-hydroxyeicosatetraenoic acid ethanolamide (20-HETE-EA) and 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed:18698000, PubMed:21289075). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis (PubMed:21576599). Catalyzes the oxidative transformations of all-trans retinol to all-trans retinal, a precursor for the active form all-trans-retinoic acid (PubMed:10681376). Also involved in the oxidative metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.

Gene Wiki entry for CYP2D6 Gene

PharmGKB "VIP" Summary for CYP2D6 Gene

Additional gene information for CYP2D6 Gene

No data available for Tocris Summary , Rfam classification and piRNA Summary for CYP2D6 Gene

Genomics for CYP2D6 Gene

GeneHancer (GH) Regulatory Elements for CYP2D6 Gene

Promoters and enhancers for CYP2D6 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH22J042130 Promoter 0.7 EPDnew 500.7 +4.5 4479 0.1 FOXA2 RXRA NR2F6 HNF4A REST AGO1 HNRNPL SP1 ENSG00000227370 CYP2D6 LOC102723722 NDUFA6-DT
GH22J042129 Promoter 0.3 EPDnew 546.7 +5.4 5440 0.1 CYP2D6 LOC102723722 ENSG00000227370 NDUFA6-DT
GH22J042088 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas 53.3 +45.1 45098 3.1 RXRA EP300 FOXK2 ZBTB40 CTCF SIN3A TCF12 NRF1 USF1 POLR2G NDUFA6 NDUFA6-DT ENSG00000270083 SMDT1 CYP2D6 NFAM1 CENPM CCDC134
GH22J042069 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas 50.1 +64.4 64430 3.3 EP300 TCF12 NRF1 POLR2G SP1 ZFX ZIC2 POLR2A ZBTB10 ZBTB11 ENSG00000286659 NAGA SMDT1 CYP2D6 WBP2NL NDUFA6-DT
GH22J042077 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas 44.1 +56.1 56116 3.9 ZBTB40 EP300 SIN3A NRF1 TCF12 POLR2G SP1 NCOR1 GTF2E2 PHF8 SMDT1 lnc-NDUFA6-2 CYP2D6 XRCC6 EP300 PHF5A RPL5P34 EP300-AS1 ZC3H7B NDUFA6-DT
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around CYP2D6 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for CYP2D6

Top Transcription factor binding sites by QIAGEN in the CYP2D6 gene promoter:
  • NF-kappaB1
  • PPAR-gamma1
  • PPAR-gamma2

Genomic Locations for CYP2D6 Gene

Genomic Locations for CYP2D6 Gene
chr22:42,125,656-42,135,378
(GRCh38/hg38)
Size:
9,723 bases
Orientation:
Minus strand
chr22:42,522,501-42,526,908
(GRCh37/hg19)
Size:
4,408 bases
Orientation:
Minus strand

Genomic View for CYP2D6 Gene

Genes around CYP2D6 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CYP2D6 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CYP2D6 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CYP2D6 Gene

Proteins for CYP2D6 Gene

  • Protein details for CYP2D6 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P10635-CP2D6_HUMAN
    Recommended name:
    Cytochrome P450 2D6
    Protein Accession:
    P10635
    Secondary Accessions:
    • Q16752
    • Q2XND6
    • Q2XND7
    • Q2XNE0
    • Q6B012
    • Q6NXU8

    Protein attributes for CYP2D6 Gene

    Size:
    497 amino acids
    Molecular mass:
    55769 Da
    Cofactor:
    Name=heme; Xref=ChEBI:CHEBI:30413;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for CYP2D6 Gene

    Alternative splice isoforms for CYP2D6 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CYP2D6 Gene

Selected DME Specific Peptides for CYP2D6 Gene

P10635:
  • EAFLPFS
  • VTTSTTL
  • EKAKGNPESSFND
  • NTPYCFDQLRRRFG
  • TSRDIEVQ
  • QLDELLTEHRMTWDPAQPPRDLTEAFLAEMEK
  • RFHPEHFLDAQG
  • PFSAGRRACLGEPLARMELFLFFT
  • NLSSVLK
  • AVIHEVQRF
  • GEDTADRPPVPI
  • GRPFRPNGLLDKAVSNVIASLTC
  • GLGKKSLEQWVT
  • GKKSLEQWVTEEA
  • LARYGPAWR
  • TLAWGLLLMILHPDVQRRVQQEIDDVIG
  • LLVDLMHRRQRWAARYPPGP
  • VIGQVRRPEM
  • LSSVLKD
  • GRRFEYDDPR

Post-translational modifications for CYP2D6 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for CYP2D6 Gene

Antibody Products

  • Santa Cruz Biotechnology (SCBT) Antibodies for CYP2D6

Domains & Families for CYP2D6 Gene

Gene Families for CYP2D6 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for CYP2D6 Gene

Blocks:
  • E-class P450 group I signature
  • CYP2D P450 family signature
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for CYP2D6 Gene

GenScript: Design optimal peptide antigens:
  • Nonfunctional cytochrome P450 family 2 subfamily D polypeptide 6 (A9QKR9_HUMAN)
  • Cytochrome P450, family 2, subfamily D, polypeptide 6, isoform CRA_a (C1ID52_HUMAN)
  • Cytochrome P450 2D6 (C1ID54_HUMAN)
  • Nonfunctional cytochrom P450 family 2 subfamily D polypeptide 6 (C4MDQ5_HUMAN)
  • Debrisoquine 4-hydroxylase (CP2D6_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P10635

UniProtKB/Swiss-Prot:

CP2D6_HUMAN :
  • Belongs to the cytochrome P450 family.
Family:
  • Belongs to the cytochrome P450 family.
genes like me logo Genes that share domains with CYP2D6: view

Function for CYP2D6 Gene

Molecular function for CYP2D6 Gene

UniProtKB/Swiss-Prot Function:
A cytochrome P450 monooxygenase involved in the metabolism of fatty acids, steroids and retinoids (PubMed:18698000, PubMed:19965576, PubMed:20972997, PubMed:21289075, PubMed:21576599). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed:18698000, PubMed:19965576, PubMed:20972997, PubMed:21289075, PubMed:21576599). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) (PubMed:19965576, PubMed:20972997). Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 20-hydroxyeicosatetraenoic acid ethanolamide (20-HETE-EA) and 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed:18698000, PubMed:21289075). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis (PubMed:21576599). Catalyzes the oxidative transformations of all-trans retinol to all-trans retinal, a precursor for the active form all-trans-retinoic acid (PubMed:10681376). Also involved in the oxidative metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = (8R,9S)-epoxy-(5Z,11Z,14Z)-eicosatrienoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:49884, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:32395, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:131975; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:49885; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = (11R,12S)-epoxy-(5Z,8Z,14Z)-eicosatrienoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:49880, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:32395, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:131970; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:49881; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = (14S,15R)-epoxy-(5Z,8Z,11Z)-eicosatrienoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:49856, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:32395, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:131964; Evidence={ECO:0000269 PubMed:19965576, ECO:0000269 PubMed:20972997}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:49857; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(8,9-epoxy-5Z,11Z,14Z-eicosatrienoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:53140, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:2700, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:136989; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:53141; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(11,12-epoxy-5Z,8Z,14Z-eicosatrienoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:53144, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:2700, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:136990; Evidence={ECO:0000269 PubMed:18698000, ECO:0000269 PubMed:21289075}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:53145; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(14,15-epoxy-5Z,8Z,11Z-eicosatrienoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:53148, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:2700, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:136991; Evidence={ECO:0000269 PubMed:18698000, ECO:0000269 PubMed:21289075}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:53149; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(20-hydroxy-5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:53152, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:2700, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:136992; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:53153; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate + O2 + reduced [NADPH--hemoprotein reductase] = (17S,18R)-epoxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:39783, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:58562, ChEBI:CHEBI:76635; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:39784; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = (19R,20S)-epoxy-(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:52120, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:77016, ChEBI:CHEBI:136410; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:52121; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = (19S,20R)-epoxy-(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:52124, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210, ChEBI:CHEBI:77016, ChEBI:CHEBI:136411; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:52125; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = 25-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:50256, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:16113, ChEBI:CHEBI:42977, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:50257; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=all-trans-retinol + O2 + reduced [NADPH--hemoprotein reductase] = all-trans-retinal + H(+) + 2 H2O + oxidized [NADPH--hemoprotein reductase]; Xref=Rhea:RHEA:42092, Rhea:RHEA-COMP:11964, Rhea:RHEA-COMP:11965, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:17336, ChEBI:CHEBI:17898, ChEBI:CHEBI:57618, ChEBI:CHEBI:58210; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:42093; Evidence=. ;.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=67 uM for all-trans retinol {ECO:0000269 PubMed:10681376}; KM=1.3 uM for anandamide (oxidation to 20-HETE) {ECO:0000269 PubMed:18698000}; KM=2.1 uM for anandamide (oxidation to 8,9-EpETrE-EA) {ECO:0000269 PubMed:18698000}; KM=2.6 uM for anandamide (oxidation to 11,12-EpETrE-EA) {ECO:0000269 PubMed:18698000}; KM=2.8 uM for anandamide (oxidation to 14,15-EpETrE-EA) {ECO:0000269 PubMed:18698000}; Vmax=193 pmol/min/nmol enzyme toward all-trans retinol {ECO:0000269 PubMed:10681376}; Vmax=3.7 pmol/min/nmol enzyme toward anandamide (oxidation to 20-HETE) {ECO:0000269 PubMed:18698000}; Vmax=1.6 pmol/min/nmol enzyme toward anandamide (oxidation to 8,9-EpETrE-EA) {ECO:0000269 PubMed:18698000}; Vmax=1.1 pmol/min/nmol enzyme toward anandamide (oxidation to 11,12-EpETrE-EA) {ECO:0000269 PubMed:18698000}; Vmax=1.3 pmol/min/nmol enzyme toward anandamide (oxidation to 14,15-EpETrE-EA) {ECO:0000269 PubMed:18698000};
UniProtKB/Swiss-Prot Induction:
By pregnancy.

Enzyme Numbers (IUBMB) for CYP2D6 Gene

Phenotypes From GWAS Catalog for CYP2D6 Gene

Gene Ontology (GO) - Molecular Function for CYP2D6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004497 monooxygenase activity IDA 15327587
GO:0005506 iron ion binding IEA --
GO:0008144 drug binding IDA 19448135
GO:0008395 steroid hydroxylase activity IBA 21873635
GO:0016491 oxidoreductase activity IEA,IDA 15039299
genes like me logo Genes that share ontologies with CYP2D6: view
genes like me logo Genes that share phenotypes with CYP2D6: view

Human Phenotype Ontology for CYP2D6 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

CRISPR Products

miRNA for CYP2D6 Gene

miRTarBase miRNAs that target CYP2D6

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CYP2D6

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for CYP2D6 Gene

Localization for CYP2D6 Gene

Subcellular locations from UniProtKB/Swiss-Prot for CYP2D6 Gene

Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CYP2D6 gene
Compartment Confidence
endoplasmic reticulum 5
mitochondrion 4
cytosol 3
plasma membrane 2
extracellular 2
cytoskeleton 2
peroxisome 2
nucleus 2
lysosome 2
golgi apparatus 2
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for CYP2D6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IBA 21873635
GO:0005739 mitochondrion IDA 19438707
GO:0005783 endoplasmic reticulum TAS 19438707
GO:0005789 endoplasmic reticulum membrane TAS --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with CYP2D6: view

Pathways & Interactions for CYP2D6 Gene

PathCards logo

SuperPathways for CYP2D6 Gene

SuperPathway Contained pathways
1 Imipramine/Desipramine Pathway, Pharmacokinetics
2 Cytochrome P450 - arranged by substrate type
.01
3 Drug metabolism - cytochrome P450
.31
4 Carvedilol Pathway, Pharmacokinetics
5 Acetaminophen Pathway (therapeutic doses), Pharmacokinetics
.42
genes like me logo Genes that share pathways with CYP2D6: view

UniProtKB/Swiss-Prot P10635-CP2D6_HUMAN

  • Pathway: Cofactor metabolism; retinol metabolism.
  • Pathway: Lipid metabolism; fatty acid metabolism.
  • Pathway: Steroid metabolism; cholesterol metabolism.

Interacting Proteins for CYP2D6 Gene

;

Gene Ontology (GO) - Biological Process for CYP2D6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006082 organic acid metabolic process IBA 21873635
GO:0006629 lipid metabolic process IEA --
GO:0006631 fatty acid metabolic process IEA --
GO:0006805 xenobiotic metabolic process TAS 19438707
GO:0008202 steroid metabolic process IMP 18356043
genes like me logo Genes that share ontologies with CYP2D6: view

No data available for SIGNOR curated interactions for CYP2D6 Gene

Drugs & Compounds for CYP2D6 Gene

(614) Drugs for CYP2D6 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Aripiprazole Approved, Investigational Pharma Antagonist, Full agonist, Agonist, Enzyme, substrate Antipsychotic, High affinity D2 and 5-HT1A receptor partial agonist; also 5-HT2A antagonist 395
Citalopram Approved Pharma Enzyme, substrate, inhibitor 582
Clomipramine Approved, Investigational, Vet_approved Pharma Enzyme, substrate, inhibitor 25
Codeine Approved, Illicit Pharma Full agonist, Agonist, Enzyme, substrate 93
Desipramine Approved, Investigational Pharma Enzyme, substrate, inhibitor 41

(86) Additional Compounds for CYP2D6 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
nadph
  • 2'-(Dihydrogen phosphate) 5'-(trihydrogen pyrophosphate) adenosine 5'-ester with 1,4-dihydro-1-b-D-ribofuranosylnicotinamide
  • 2'-(Dihydrogen phosphate) 5'-(trihydrogen pyrophosphate) adenosine 5'-ester with 1,4-dihydro-1-beta-delta-ribofuranosylnicotinamide
  • Adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) p'-5'-ester with 1,4-dihydro-1-beta-D-ribofuranosyl-3-pyridinecarboxamide
  • Adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) p'-5'-ester with 1,4-dihydro-1-beta-delta-ribofuranosyl-3-pyridinecarboxamide
  • b-NADPH
53-57-6
Paraxanthine
  • 3,7-dihydro-1,7-Dimethyl-1H-purine-2,6-dione
  • P-Xanthine
  • 1,7-Dimethyl-xanthine
  • 1,7-Dimethylxanthine
611-59-6
11,12,15-THETA
  • 11,12,15-Trihydroxyicosatrienoic acid
  • (5Z,8Z,13E)-(15S)-11,12,15-Trihydroxyeicosa-5,8,12-trienoic acid
  • (5Z,8Z,13E)-(15S)-11,12,15-Trihydroxyicosa-5,8,12-trienoic acid
  • 11,12,15-Trihydroxyicosatrienoate
  • (5Z,8Z,13E)-(15S)-11,12,15-Trihydroxyeicosa-5,8,12-trienoate
11,12-EpETrE
  • (+/-)11(12)-eet
  • (+/-)11(12)-epetre
  • (+/-)11,12-epetre
  • (5Z,8Z,14Z)-11,12-Epoxyeicosa-5,8,14-trienoate
  • (5Z,8Z,14Z)-11,12-Epoxyeicosa-5,8,14-trienoic acid
81276-02-0
11,14,15-THETA
  • 11,14,15-Trihydroxyicosatrienoic acid
  • (5Z,8Z,12E)-11,14,15-Trihydroxyeicosa-5,8,12-trienoic acid
  • (5Z,8Z,12E)-11,14,15-Trihydroxyicosa-5,8,12-trienoic acid
  • 11,14,15-Trihydroxyicosatrienoate
  • (5Z,8Z,12E)-11,14,15-Trihydroxyeicosa-5,8,12-trienoate

(4) ApexBio Compounds for CYP2D6 Gene

Compound Action Cas Number
Abiraterone acetate Cytochrome p450 17a1 inhibitor 154229-18-2
Avasimibe ACAT inhibitor,orally bioavailable 166518-60-1
Ifosfamide Cytostatic agent 3778-73-2
Ketoconazole Inhibitor of cyclosporine oxidase and testosterone 6 beta-hydroxylase 65277-42-1
genes like me logo Genes that share compounds with CYP2D6: view

Drug Products

Transcripts for CYP2D6 Gene

mRNA/cDNA for CYP2D6 Gene

2 REFSEQ mRNAs :
18 NCBI additional mRNA sequence :
5 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CYP2D6

Alternative Splicing Database (ASD) splice patterns (SP) for CYP2D6 Gene

ExUns: 1 ^ 2a · 2b ^ 3a · 3b · 3c ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13a · 13b · 13c ^ 14 ^ 15 ^ 16 ^ 17a ·
SP1: -
SP2: - -
SP3:
SP4: - -
SP5: -
SP6: - - - - - - - - - - - - - - - -
SP7:
SP8: -
SP9:
SP10:
SP11: - - - - - - - - - -
SP12:
SP13: - -

ExUns: 17b ^ 18 ^ 19 ^ 20a · 20b ^ 21
SP1:
SP2:
SP3:
SP4:
SP5:
SP6: -
SP7:
SP8:
SP9:
SP10:
SP11: - - - - -
SP12:
SP13:

Relevant External Links for CYP2D6 Gene

GeneLoc Exon Structure for
CYP2D6

Expression for CYP2D6 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for CYP2D6 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for CYP2D6 Gene

This gene is overexpressed in Liver (x40.6).

Protein differential expression in normal tissues from HIPED for CYP2D6 Gene

This gene is overexpressed in Liver (63.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for CYP2D6 Gene



Protein tissue co-expression partners for CYP2D6 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for CYP2D6

SOURCE GeneReport for Unigene cluster for CYP2D6 Gene:

Hs.333497

Evidence on tissue expression from TISSUES for CYP2D6 Gene

  • Liver(4.9)
  • Nervous system(3.3)
  • Blood(3.1)
  • Urine(2.7)
  • Kidney(2.6)
  • Intestine(2.4)
  • Heart(2)
genes like me logo Genes that share expression patterns with CYP2D6: view

No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for CYP2D6 Gene

Orthologs for CYP2D6 Gene

This gene was present in the common ancestor of animals.

Orthologs for CYP2D6 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CYP2D6 31 30
  • 98.52 (n)
OneToOne
cow
(Bos Taurus)
Mammalia MGC127055 31
  • 77 (a)
OneToMany
-- 31
  • 74 (a)
OneToMany
rat
(Rattus norvegicus)
Mammalia Cyp2d3 30
  • 76.54 (n)
mouse
(Mus musculus)
Mammalia Cyp2d22 31
  • 75 (a)
OneToMany
Cyp2d26 31
  • 71 (a)
OneToMany
Cyp2d40 31
  • 71 (a)
OneToMany
Cyp2d9 31
  • 69 (a)
OneToMany
Cyp2d10 31
  • 69 (a)
OneToMany
Cyp2d34 31
  • 68 (a)
OneToMany
Cyp2d11 31
  • 67 (a)
OneToMany
Cyp2d12 31
  • 67 (a)
OneToMany
oppossum
(Monodelphis domestica)
Mammalia CYP2D6 31
  • 58 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia CYP2D6 31
  • 52 (a)
OneToOne
chicken
(Gallus gallus)
Aves CYP2D6 30
  • 60.03 (n)
GGA.10540 31
  • 55 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia CYP2D6 31
  • 48 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia cyp2d6 30
  • 58.32 (n)
zebrafish
(Danio rerio)
Actinopterygii cyp2aa12 31
  • 41 (a)
ManyToMany
cyp2aa11 31
  • 40 (a)
ManyToMany
cyp2aa7 31
  • 40 (a)
ManyToMany
cyp2aa2 31
  • 39 (a)
ManyToMany
cyp2aa1 31
  • 38 (a)
ManyToMany
cyp2aa4 31
  • 38 (a)
ManyToMany
cyp2aa3 31
  • 38 (a)
ManyToMany
cyp2aa8 31
  • 37 (a)
ManyToMany
cyp2aa9 31
  • 37 (a)
ManyToMany
fruit fly
(Drosophila melanogaster)
Insecta Cyp18a1 32
  • 34 (a)
Cyp305a1 32
  • 30 (a)
Cyp303a1 32
  • 29 (a)
Cyp307a1 32
  • 27 (a)
worm
(Caenorhabditis elegans)
Secernentea K09A11.4 32
  • 36 (a)
K09A11.3 32
  • 33 (a)
B0304.3 32
  • 33 (a)
Y49C4A.9 32
  • 33 (a)
C50H11.15 32
  • 33 (a)
F44C8.1 32
  • 32 (a)
F41B5.4 32
  • 32 (a)
Y5H2B.6 32
  • 32 (a)
F41B5.3 32
  • 32 (a)
K09A11.2 32
  • 31 (a)
C12D5.7 32
  • 31 (a)
C45H4.2 32
  • 31 (a)
F41B5.7 32
  • 30 (a)
F42A9.5 32
  • 29 (a)
C34B7.3 32
  • 29 (a)
Species where no ortholog for CYP2D6 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • dog (Canis familiaris)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for CYP2D6 Gene

ENSEMBL:
Gene Tree for CYP2D6 (if available)
TreeFam:
Gene Tree for CYP2D6 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for CYP2D6: view image

Paralogs for CYP2D6 Gene

(32) SIMAP similar genes for CYP2D6 Gene using alignment to 39 proteins:

  • CP2D6_HUMAN
  • A9QKR9_HUMAN
  • C1ID52_HUMAN
  • C1ID54_HUMAN
  • C4MDQ5_HUMAN
  • D0U5L8_HUMAN
  • D3IP03_HUMAN
  • D3IP04_HUMAN
  • D3IP05_HUMAN
  • D5KMQ2_HUMAN
  • D5KMR1_HUMAN
  • D5KMS0_HUMAN
  • D5KMU5_HUMAN
  • D5KMU6_HUMAN
  • D5KMZ1_HUMAN
  • D5KN01_HUMAN
  • D5KN10_HUMAN
  • D5KN50_HUMAN
  • D5KN61_HUMAN
  • D5KN64_HUMAN
  • D5KNB5_HUMAN
  • D5KND2_HUMAN
  • E7ENE7_HUMAN
  • G9CGD2_HUMAN
  • H7BY38_HUMAN
  • I1VC92_HUMAN
  • I1VC93_HUMAN
  • Q007T8_HUMAN
  • Q007T9_HUMAN
  • Q2XND0_HUMAN
  • Q2XND2_HUMAN
  • Q2XND3_HUMAN
  • Q2XND8_HUMAN
  • Q38LF9_HUMAN
  • Q38LG0_HUMAN
  • Q38LG2_HUMAN
  • Q3KPF3_HUMAN
  • Q6ICD8_HUMAN
  • Q6NWU0_HUMAN

Pseudogenes.org Pseudogenes for CYP2D6 Gene

genes like me logo Genes that share paralogs with CYP2D6: view

Variants for CYP2D6 Gene

Polymorphic Variants from UniProtKB/Swiss-Prot for CYP2D6 Gene

CP2D6_HUMAN-P10635
Genetic variations in CYP2D6 are the cause of poor drug metabolism CYP2D6-related [MIM:608902]. The CYP2D6 gene is highly polymorphic. CYP2D6 activity ranges widely within a population comprising ultrarapid (UM), extensive (EM), intermediate (IM) and poor (PM) metabolizer phenotypes. UM and PM are those most at risk for treatment failure or dose-dependent drug toxicity, respectively. Of the Caucasian populations of Europe and North America, 5%-10% are of the PM phenotype and are unable to metabolize the antihypersensitive drug debrisoquine and numerous other drugs. Different alleles are known, including CYP2D6*1 (PubMed:15768052), CYP2D6*2 (PubMed:25469868), CYP2D6*6B/6C (PubMed:7868129), CYP2D6*7 also known CYP2D6E (PubMed:7845481), CYP2D6*9 also known CYP2D6C (PubMed:1844820), CYP2D6*10 also known CYP2D6J (PubMed:8287064, PubMed:25469868), CYP2D6*12 (PubMed:8655150), CYP2D6*14 (PubMed:10064570), CYP2D6*17 also known CYP2D6Z (PubMed:8971426), CYP2D6*41B (PubMed:15768052), CYP2D6*45A (PubMed:15768052), CYP2D6*45B (PubMed:15768052), CYP2D6*46 (PubMed:15768052), CYP2D6*87 (PubMed:25469868), CYP2D6*88 (PubMed:25469868), CYP2D6*89 (PubMed:25469868), CYP2D6*90 (PubMed:25469868), CYP2D6*91 (PubMed:25469868), CYP2D6*93 (PubMed:25469868), C CYP2D6*94 (PubMed:25469868), CYP2D6*97 (PubMed:25469868) and CYP2D6*98 (PubMed:25469868). Isozymes CYP2D6.45 (Lys-155, Cys-296 and Thr-486) and CYP2D6.46 (His-26, Lys-155, Cys-296 and Thr-486) are functional (PubMed:15768052). The sequence shown is that of isozyme CYP2D6.1 corresponding to allele CYP2D6*1.

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for CYP2D6 Gene

SNP ID Clinical significance and condition Chr 22 pos Variation AA Info Type
675907 Likely Benign: not provided 42,129,042(-) T/C MISSENSE_VARIANT,INTRON_VARIANT
676319 Likely Benign: not provided 42,129,910(-) C/G SPLICE_ACCEPTOR_VARIANT
676320 Likely Benign: not provided 42,130,761(-) C/T MISSENSE_VARIANT
678343 Likely Benign: not provided 42,130,654(-) C/CA FRAMESHIFT_VARIANT
rs1065852 Likely Benign, Other: Debrisoquine, poor metabolism of; not specified; not provided. - 42,130,692(-) G/Ap.Pro34Ser MISSENSE_VARIANT

Additional dbSNP identifiers (rs#s) for CYP2D6 Gene

Structural Variations from Database of Genomic Variants (DGV) for CYP2D6 Gene

Variant ID Type Subtype PubMed ID
dgv1319e212 CNV gain 25503493
dgv1320e212 CNV loss 25503493
dgv733e201 CNV deletion 23290073
dgv841e214 CNV gain 21293372
esv2171396 CNV deletion 18987734
esv2724275 CNV deletion 23290073
esv27312 CNV gain+loss 19812545
esv33893 CNV gain+loss 17666407
esv3446082 CNV duplication 20981092
esv3449611 CNV duplication 20981092
esv3568417 CNV loss 25503493
esv3575484 CNV gain 25503493
esv3647809 CNV loss 21293372
esv6632 CNV loss 19470904
nsv1076539 CNV duplication 25765185
nsv1110402 CNV duplication 24896259
nsv1139782 CNV duplication 24896259
nsv3641 CNV deletion 18451855
nsv3642 CNV insertion 18451855
nsv3643 CNV insertion 18451855
nsv436350 CNV deletion 17901297
nsv498989 CNV loss 21111241
nsv508737 CNV insertion 20534489
nsv829243 CNV loss 20364138
nsv834210 CNV loss 17160897
nsv955164 CNV deletion 24416366

Variation tolerance for CYP2D6 Gene

Residual Variation Intolerance Score: 98.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 11.26; 92.52% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for CYP2D6 Gene

The Human Cytochrome P450 Allele Nomenclature Database
CYP2D6
Human Gene Mutation Database (HGMD)
CYP2D6
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CYP2D6

Disorders for CYP2D6 Gene

MalaCards: The human disease database

(63) MalaCards diseases for CYP2D6 Gene - From: OMIM, Orphanet, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards

Genatlas disease for CYP2D6 Gene

debrisoquine sensitivity (poor metabolizer,CYP2D6 mutant) including neuroleptic malignant syndrome,putative susceptibility gene for leukemia

Additional Disease Information for CYP2D6

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with CYP2D6: view

No data available for UniProtKB/Swiss-Prot for CYP2D6 Gene

Publications for CYP2D6 Gene

  1. A novel mutant variant of the CYP2D6 gene (CYP2D6*17) common in a black African population: association with diminished debrisoquine hydroxylase activity. (PMID: 8971426) Masimirembwa C … Ingelman-Sundberg M (British journal of clinical pharmacology 1996) 3 4 23 41 54
  2. A missense mutation in exon 6 of the CYP2D6 gene leading to a histidine 324 to proline exchange is associated with the poor metabolizer phenotype of sparteine. (PMID: 7845481) Evert B … Eichelbaum M (Naunyn-Schmiedeberg's archives of pharmacology 1994) 3 4 23 41 54
  3. Genetic susceptibility factors for multiple chemical sensitivity revisited. (PMID: 20185366) Berg ND … Elberling J (International journal of hygiene and environmental health 2010) 3 23 41 54
  4. Effects of the serotonin 1A, 2A, 2C, 3A, and 3B and serotonin transporter gene polymorphisms on the occurrence of paroxetine discontinuation syndrome. (PMID: 20075642) Murata Y … Mine K (Journal of clinical psychopharmacology 2010) 3 23 41 54
  5. Role of the CYP2D6, EPHX1, MPO, and NQO1 genes in the susceptibility to acute lymphoblastic leukemia in Brazilian children. (PMID: 19593802) Silveira Vda S … Tone LG (Environmental and molecular mutagenesis 2010) 3 23 41 54

Products for CYP2D6 Gene

  • Signalway ELISA kits for CYP2D6
  • Signalway Proteins for CYP2D6

Sources for CYP2D6 Gene