The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing ... See more...

Aliases for CPD Gene

Aliases for CPD Gene

  • Carboxypeptidase D 2 3 4 5
  • Metallocarboxypeptidase D 2 3 4
  • EC 3.4.17.22 4 51
  • GP180 2 3
  • EC 3.4.17 51
  • Gp180 4
  • CPD 5

External Ids for CPD Gene

Previous GeneCards Identifiers for CPD Gene

  • GC17P028459
  • GC17P030612
  • GC17P028851
  • GC17P025730
  • GC17P028705
  • GC17P024916

Summaries for CPD Gene

Entrez Gene Summary for CPD Gene

  • The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for CPD Gene

CPD (Carboxypeptidase D) is a Protein Coding gene. Diseases associated with CPD include Hepatitis B and Hepatitis. Among its related pathways are Clathrin derived vesicle budding and Vesicle-mediated transport. Gene Ontology (GO) annotations related to this gene include metallocarboxypeptidase activity and serine-type carboxypeptidase activity. An important paralog of this gene is CPZ.

Gene Wiki entry for CPD Gene

No data available for CIViC Summary , UniProtKB/Swiss-Prot Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for CPD Gene

Genomics for CPD Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for CPD Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around CPD on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for CPD

Top Transcription factor binding sites by QIAGEN in the CPD gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • CREB
  • deltaCREB
  • GATA-3

Genomic Locations for CPD Gene

Genomic Locations for CPD Gene
chr17:30,378,927-30,469,989
(GRCh38/hg38)
Size:
91,063 bases
Orientation:
Plus strand
chr17:28,705,923-28,797,007
(GRCh37/hg19)
Size:
91,085 bases
Orientation:
Plus strand

Genomic View for CPD Gene

Genes around CPD on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CPD Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CPD Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CPD Gene

Proteins for CPD Gene

  • Protein details for CPD Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O75976-CBPD_HUMAN
    Recommended name:
    Carboxypeptidase D
    Protein Accession:
    O75976
    Secondary Accessions:
    • B7Z7T9
    • B7ZAU4
    • F5GZH6
    • O15377
    • Q86SH9
    • Q86XE6

    Protein attributes for CPD Gene

    Size:
    1380 amino acids
    Molecular mass:
    152931 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for CPD Gene

    Alternative splice isoforms for CPD Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CPD Gene

Selected DME Specific Peptides for CPD Gene

O75976:
  • QTVENKETLKHLAS
  • GLENATI
  • LTACIIWC
  • DMEIFLRR
  • EYFPHGITNGA
  • GDYWRLL
  • FVLSANLHGG
  • WYDVEGGMQDYNYVWANCFEITLELSCCKYPP
  • YPFVLSANLHGGSLVVNYP
  • YSKSPDDAVFQQ
  • PETKAIIENLI
  • RELYVMEISDNPG
  • MPSMNPDGYEKSQEGD
  • NSRGRDLNRSFPDQF
  • YLLPSLNPDGFERAREGDCG
  • GEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVT
  • DLNRNFPD
  • MPSMNPDG
  • TNCFEVTIELGCVKYP
  • CFEITLELSC
  • EWHSHLGSMKD
  • ALSYSKEN
  • IWSLEISNKPN
  • INHPVTTYK
  • ELSCCKYP
  • GHCPEITVYTSCCYFPSA
  • YKDLSEFLRGL
  • GFVLDATDGRGILNAT
  • QEWENNRESL
  • GITNGAHWY
  • GNMHGNE
  • CSIKSNRHKDGF
  • LPGRPQVKLVGNMHGDE
  • LSGNLHGGSVVASYP
  • NYPHITNLT
  • NRIFGLPRELVVTV
  • SEPEEPKIRFVAGIHGNAPVGTELLLALAEFLC
  • PSMNPDGYE
  • WYNVPGGMQDWNYL

Post-translational modifications for CPD Gene

  • Glycosylation at Thr40, Thr41, Thr42, Thr43, Thr44, Ser45, Asn399, Asn410, Asn172, Asn429, Asn217, Thr489, Asn522, Asn626, Asn811, Asn855, Asn867, Asn879, Asn955, Asn978, Asn1070, and Asn1142
  • Modification sites at PhosphoSitePlus
  • Glycosylation from GlyConnect

Other Protein References for CPD Gene

Domains & Families for CPD Gene

Gene Families for CPD Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for CPD Gene

Suggested Antigen Peptide Sequences for CPD Gene

GenScript: Design optimal peptide antigens:
  • gp180 (CBPD_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O75976

UniProtKB/Swiss-Prot:

CBPD_HUMAN :
  • There are 3 carboxypeptidase-like domains. Only the first two domains seem to have kept a catalytic activity.
  • Belongs to the peptidase M14 family.
Domain:
  • There are 3 carboxypeptidase-like domains. Only the first two domains seem to have kept a catalytic activity.
Family:
  • Belongs to the peptidase M14 family.
genes like me logo Genes that share domains with CPD: view

Function for CPD Gene

Molecular function for CPD Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Releases C-terminal Arg and Lys from polypeptides.; EC=3.4.17.22;.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
pH dependence: Optimum pH is 6.0-6.5.;
GENATLAS Biochemistry:
carboxypeptidase D,175-180kDa ,regulatory family,highly expressed in placenta,pancreas,hepatoma cells,most cell glycoprotein binding duck hepatitis B virus particles,involved in secretory pathway

Enzyme Numbers (IUBMB) for CPD Gene

Phenotypes From GWAS Catalog for CPD Gene

Gene Ontology (GO) - Molecular Function for CPD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004180 carboxypeptidase activity IEA --
GO:0004181 metallocarboxypeptidase activity IEA,IBA 21873635
GO:0004185 serine-type carboxypeptidase activity IEA --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
genes like me logo Genes that share ontologies with CPD: view
genes like me logo Genes that share phenotypes with CPD: view

Animal Model Products

  • Taconic Biosciences Mouse Models for CPD

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CPD

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CPD Gene

Localization for CPD Gene

Subcellular locations from UniProtKB/Swiss-Prot for CPD Gene

Cell membrane. Single-pass type I membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CPD gene
Compartment Confidence
plasma membrane 4
extracellular 4
endoplasmic reticulum 2
endosome 2
cytosol 2
golgi apparatus 2
cytoskeleton 1
mitochondrion 1
nucleus 1
lysosome 1
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nuclear membrane (2)
  • Nuclear speckles (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for CPD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005615 extracellular space IBA 21873635
GO:0005886 plasma membrane IEA --
GO:0016020 membrane TAS,HDA 19946888
GO:0016021 integral component of membrane IEA --
GO:0070062 extracellular exosome HDA 19199708
genes like me logo Genes that share ontologies with CPD: view

Pathways & Interactions for CPD Gene

genes like me logo Genes that share pathways with CPD: view

Gene Ontology (GO) - Biological Process for CPD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0006518 peptide metabolic process IBA 21873635
GO:0016485 protein processing IBA 21873635
genes like me logo Genes that share ontologies with CPD: view

No data available for SIGNOR curated interactions for CPD Gene

Drugs & Compounds for CPD Gene

(19) Drugs for CPD Gene - From: DrugBank, ClinicalTrials, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dexamethasone Approved, Investigational, Vet_approved Pharma Agonist Anti-inflammatory glucocorticoid 2886
Dexamethasone acetate Approved, Investigational, Vet_approved Pharma 2886
Pomalidomide Approved Pharma 180
Zinc Approved, Investigational Pharma 1594
Guanidinoethylmercaptosuccinic acid Experimental Pharma Target 0
genes like me logo Genes that share compounds with CPD: view

Transcripts for CPD Gene

mRNA/cDNA for CPD Gene

2 REFSEQ mRNAs :
14 NCBI additional mRNA sequence :
10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CPD

Alternative Splicing Database (ASD) splice patterns (SP) for CPD Gene

No ASD Table

Relevant External Links for CPD Gene

GeneLoc Exon Structure for
CPD

Expression for CPD Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for CPD Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for CPD Gene

This gene is overexpressed in Whole Blood (x5.9).

Protein differential expression in normal tissues from HIPED for CPD Gene

This gene is overexpressed in Salivary gland (21.6) and Oral epithelium (8.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for CPD Gene



Protein tissue co-expression partners for CPD Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for CPD

SOURCE GeneReport for Unigene cluster for CPD Gene:

Hs.446079

mRNA Expression by UniProt/SwissProt for CPD Gene:

O75976-CBPD_HUMAN
Tissue specificity: Highly expressed in placenta, pancreas and hepatoma cells. Lower levels found in skeletal muscle, heart and colon carcinoma and melanoma cell lines.

Evidence on tissue expression from TISSUES for CPD Gene

  • Nervous system(4.8)
  • Liver(4.6)
  • Pancreas(2.6)
  • Kidney(2.2)
  • Heart(2)
genes like me logo Genes that share expression patterns with CPD: view

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for CPD Gene

Orthologs for CPD Gene

This gene was present in the common ancestor of animals.

Orthologs for CPD Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia CPD 30 31
  • 99.71 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia CPD 30 31
  • 92.52 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia CPD 31
  • 92 (a)
OneToOne
Mouse
(Mus musculus)
Mammalia Cpd 30 17 31
  • 88.26 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Cpd 30
  • 87.83 (n)
Platypus
(Ornithorhynchus anatinus)
Mammalia CPD 31
  • 87 (a)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia CPD 31
  • 81 (a)
OneToOne
Chicken
(Gallus gallus)
Aves CPD 30 31
  • 75.04 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia -- 31
  • 34 (a)
ManyToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia LOC101730225 30
  • 69.58 (n)
Zebrafish
(Danio rerio)
Actinopterygii cpda 30 31
  • 62.68 (n)
OneToMany
cpdb 31
  • 46 (a)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta svr 30 31 32
  • 48.74 (n)
OneToOne
CG4678 32
  • 44 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP002414 30
  • 47.32 (n)
Worm
(Caenorhabditis elegans)
Secernentea cpd-2 30 31
  • 53.75 (n)
ManyToMany
F59A3.1 32
  • 49 (a)
T27A8.1 32
  • 45 (a)
F01D4.4 32
  • 42 (a)
cpd-1 31
  • 28 (a)
ManyToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 56 (a)
OneToOne
Species where no ortholog for CPD was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for CPD Gene

ENSEMBL:
Gene Tree for CPD (if available)
TreeFam:
Gene Tree for CPD (if available)
Aminode:
Evolutionary constrained regions (ECRs) for CPD: view image

Paralogs for CPD Gene

Paralogs for CPD Gene

(3) SIMAP similar genes for CPD Gene using alignment to 4 proteins:

  • CBPD_HUMAN
  • J3QQJ4_HUMAN
  • J3QRJ9_HUMAN
  • K7ELF0_HUMAN

Pseudogenes.org Pseudogenes for CPD Gene

genes like me logo Genes that share paralogs with CPD: view

Variants for CPD Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for CPD Gene

SNP ID Clinical significance and condition Chr 17 pos Variation AA Info Type
739309 Benign: not provided 30,445,843(+) C/T MISSENSE_VARIANT
770445 Benign: not provided 30,422,862(+) A/G MISSENSE_VARIANT
778687 Benign: not provided 30,378,993(+) C/A SYNONYMOUS_VARIANT
791199 Benign: not provided 30,431,785(+) T/G SYNONYMOUS_VARIANT
rs17854355 - p.His505Asn

Additional dbSNP identifiers (rs#s) for CPD Gene

Structural Variations from Database of Genomic Variants (DGV) for CPD Gene

Variant ID Type Subtype PubMed ID
esv2673490 CNV deletion 23128226
esv3554304 CNV deletion 23714750
nsv1064611 CNV gain 25217958
nsv515870 CNV gain 19592680

Variation tolerance for CPD Gene

Residual Variation Intolerance Score: 13.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.27; 62.55% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for CPD Gene

Human Gene Mutation Database (HGMD)
CPD
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CPD

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CPD Gene

Disorders for CPD Gene

MalaCards: The human disease database

(2) MalaCards diseases for CPD Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hepatitis b
  • chronic hepatitis b
hepatitis
  • hepatitis a
- elite association - COSMIC cancer census association via MalaCards
Search CPD in MalaCards View complete list of genes associated with diseases
genes like me logo Genes that share disorders with CPD: view

No data available for UniProtKB/Swiss-Prot and Genatlas for CPD Gene

Publications for CPD Gene

  1. Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains. (PMID: 9355738) Tan F … Skidgel RA (The Biochemical journal 1997) 2 3 4 23
  2. Palmitoylation of carboxypeptidase D. Implications for intracellular trafficking. (PMID: 12643288) Kalinina EV … Fricker LD (The Journal of biological chemistry 2003) 3 4 23
  3. Cloning, functional expression, and chromosomal localization of the human and mouse gp180-carboxypeptidase D-like enzyme. (PMID: 9714835) Ishikawa T … Kuroki K (Gene 1998) 3 4 23
  4. Chromosomal localization of the genes for human carboxypeptidase D (CPD) and the active 50-kilodalton subunit of human carboxypeptidase N (CPN1). (PMID: 9628828) Riley DA … Skidgel RA (Genomics 1998) 2 3 23
  5. Identification of a membrane-bound carboxypeptidase as the mammalian homolog of duck gp180, a hepatitis B virus-binding protein. (PMID: 9064476) McGwire GB … Skidgel RA (Life sciences 1997) 3 4 23

Products for CPD Gene

Sources for CPD Gene