Free for academic non-profit institutions. Other users need a Commercial license
The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing ... See more...
Aliases for CPD Gene
Aliases for CPD Gene
External Ids for CPD Gene
- HGNC: 2301
- Entrez Gene: 1362
- Ensembl: ENSG00000108582
- OMIM: 603102
- UniProtKB: O75976
Previous GeneCards Identifiers for CPD Gene
- GC17P028459
- GC17P030612
- GC17P028851
- GC17P025730
- GC17P028705
- GC17P024916
Summaries for CPD Gene
-
The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq, Jul 2008]
GeneCards Summary for CPD Gene
CPD (Carboxypeptidase D) is a Protein Coding gene. Diseases associated with CPD include Hepatitis B and Hepatitis. Among its related pathways are Clathrin derived vesicle budding and Vesicle-mediated transport. Gene Ontology (GO) annotations related to this gene include metallocarboxypeptidase activity and serine-type carboxypeptidase activity. An important paralog of this gene is CPZ.
Additional gene information for CPD Gene
- HGNC(2301)
- Entrez Gene(1362)
- Ensembl(ENSG00000108582)
- OMIM(603102)
- UniProtKB(O75976)
- Open Targets Platform(ENSG00000108582)
- Search for CPD at DataMed
- Search for CPD at HumanCyc
No data available for CIViC Summary , UniProtKB/Swiss-Prot Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for CPD Gene
Genomics for CPD Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for CPD Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around CPD on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for CPD
- Top Transcription factor binding sites by QIAGEN in the CPD gene promoter:
-
- AP-1
- ATF-2
- c-Jun
- CREB
- deltaCREB
- GATA-3
Genomic Locations for CPD Gene
Genomic Locations for CPD Gene
- chr17:30,378,927-30,469,989
- (GRCh38/hg38)
- Size:
- 91,063 bases
- Orientation:
- Plus strand
- chr17:28,705,923-28,797,007
- (GRCh37/hg19)
- Size:
- 91,085 bases
- Orientation:
- Plus strand
Genomic View for CPD Gene
Genes around CPD on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 17q11.2 by HGNC
- 17q11.2 by Entrez Gene
- 17q11.2 by Ensembl
CPD Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CPD Gene
Proteins for CPD Gene
-
Protein details for CPD Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O75976-CBPD_HUMAN
- Recommended name:
- Carboxypeptidase D
- Protein Accession:
- O75976
- B7Z7T9
- B7ZAU4
- F5GZH6
- O15377
- Q86SH9
- Q86XE6
Protein attributes for CPD Gene
- Size:
- 1380 amino acids
- Molecular mass:
- 152931 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Quaternary structure:
- No Data Available
Protein Expression for CPD Gene
Selected DME Specific Peptides for CPD Gene
- O75976:
-
- QTVENKETLKHLAS
- GLENATI
- LTACIIWC
- DMEIFLRR
- EYFPHGITNGA
- GDYWRLL
- FVLSANLHGG
- WYDVEGGMQDYNYVWANCFEITLELSCCKYPP
- YPFVLSANLHGGSLVVNYP
- YSKSPDDAVFQQ
- PETKAIIENLI
- RELYVMEISDNPG
- MPSMNPDGYEKSQEGD
- NSRGRDLNRSFPDQF
- YLLPSLNPDGFERAREGDCG
- GEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVT
- DLNRNFPD
- MPSMNPDG
- TNCFEVTIELGCVKYP
- CFEITLELSC
- EWHSHLGSMKD
- ALSYSKEN
- IWSLEISNKPN
- INHPVTTYK
- ELSCCKYP
- GHCPEITVYTSCCYFPSA
- YKDLSEFLRGL
- GFVLDATDGRGILNAT
- QEWENNRESL
- GITNGAHWY
- GNMHGNE
- CSIKSNRHKDGF
- LPGRPQVKLVGNMHGDE
- LSGNLHGGSVVASYP
- NYPHITNLT
- NRIFGLPRELVVTV
- SEPEEPKIRFVAGIHGNAPVGTELLLALAEFLC
- PSMNPDGYE
- WYNVPGGMQDWNYL
Post-translational modifications for CPD Gene
-
Glycosylation at Thr40, Thr41, Thr42, Thr43, Thr44, Ser45, Asn399, Asn410, Asn172, Asn429, Asn217, Thr489, Asn522, Asn626, Asn811, Asn855, Asn867, Asn879, Asn955, Asn978, Asn1070, and Asn1142
- NX_O75976 (NX_O75976-1)
- Modification sites at PhosphoSitePlus
-
Glycosylation from GlyConnect
- CBPD_HUMAN (1066)
Other Protein References for CPD Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ CPD Antibody
-
Custom Antibody ServicesOriGene Antibodies for CPD
- Novus Biologicals Antibodies for CPD
-
Abcam antibodies for CPD
- Invitrogen Antibodies for CPD (AFLGC-CPD)
-
Boster Bio Antibodies for CPD
Protein Products
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for CPD
- Origene Custom Protein Services for CPD
- Novus Biologicals proteins for CPD
- antibodies-online: Show 5 available CPD Proteins ranked by validation data
- Compare Top CPD Proteins
Assay Products
- antibodies-online: Show 4 available CPD Elisa Kits ranked by validation data
- Compare Top CPD Elisa Kits
-
Quality Products:
Domains & Families for CPD Gene
Gene Families for CPD Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for CPD Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for CPD Gene
- GenScript: Design optimal peptide antigens:
-
- gp180 (CBPD_HUMAN)
Graphical View of Domain Structure for InterPro Entry
O75976UniProtKB/Swiss-Prot:
CBPD_HUMAN :- There are 3 carboxypeptidase-like domains. Only the first two domains seem to have kept a catalytic activity.
- Belongs to the peptidase M14 family.
- Domain:
-
- There are 3 carboxypeptidase-like domains. Only the first two domains seem to have kept a catalytic activity.
- Family:
-
- Belongs to the peptidase M14 family.
Function for CPD Gene
Molecular function for CPD Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=Releases C-terminal Arg and Lys from polypeptides.; EC=3.4.17.22;.
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- pH dependence: Optimum pH is 6.0-6.5.;
- GENATLAS Biochemistry:
- carboxypeptidase D,175-180kDa ,regulatory family,highly expressed in placenta,pancreas,hepatoma cells,most cell glycoprotein binding duck hepatitis B virus particles,involved in secretory pathway
Enzyme Numbers (IUBMB) for CPD Gene
Phenotypes From GWAS Catalog for CPD Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004180 | carboxypeptidase activity | IEA | -- |
| GO:0004181 | metallocarboxypeptidase activity | IEA,IBA | 21873635 |
| GO:0004185 | serine-type carboxypeptidase activity | IEA | -- |
| GO:0008233 | peptidase activity | IEA | -- |
| GO:0008237 | metallopeptidase activity | IEA | -- |
Phenotypes for CPD Gene
- GenomeRNAi human phenotypes for CPD:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Decreased viability
- Increased JFH-1 genotype 2a Hepatitis C virus (HCV) infection
- Increased S DNA content
- Increased HPV18 LCR reporter activity
- Decreased viability in colon lineage
- Synthetic lethal with vaccinia virus (VACV) infection
- Decreased BPV1 E2 protein expression
Animal Model Products
-
Taconic Biosciences Mouse Models for CPD
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for CPD - Select products 50% OFF >
- * CPD CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for CPD
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CPD
-
Santa Cruz Biotechnology (SCBT) CRISPR for CPD
miRNA for CPD Gene
- miRTarBase miRNAs that target CPD
-
- hsa-miR-155-5p (MIRT020910)
- hsa-miR-196a-5p (MIRT026089)
- hsa-miR-19b-3p (MIRT031284)
- hsa-miR-320a (MIRT044809)
- hsa-miR-432-5p (MIRT440903)
- mmu-miR-5123 (MIRT584200)
- mmu-miR-5098 (MIRT584201)
- mmu-miR-466c-3p (MIRT584202)
- mmu-miR-466b-3p (MIRT584203)
- mmu-miR-466p-3p (MIRT584204)
- mmu-miR-96-5p (MIRT584205)
- mmu-miR-466f-3p (MIRT584206)
- mmu-miR-320-3p (MIRT584207)
- mmu-miR-743b-3p (MIRT595014)
- mmu-miR-743a-3p (MIRT595015)
- mmu-miR-155-5p (MIRT595016)
- mmu-miR-365-3p (MIRT595017)
- hsa-miR-214-3p (MIRT735468)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CPD
- Browse OriGene Inhibitory RNA Products For CPD
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CPD
Clone Products
- Applied Biological Materials (abm): Clones for CPD - Select products 50% OFF >
- * CPD as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for CPD
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CPD
Cell Line Products
-
Horizon Cell Lines for CPD
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CPD Gene
Localization for CPD Gene
Subcellular locations from UniProtKB/Swiss-Prot for CPD Gene
- Cell membrane. Single-pass type I membrane protein.
| Compartment | Confidence |
|---|---|
| plasma membrane | 4 |
| extracellular | 4 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| cytosol | 2 |
| golgi apparatus | 2 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| nucleus | 1 |
| lysosome | 1 |
| peroxisome | 0 |
- Nuclear membrane (2)
- Nuclear speckles (2)
- Nucleoplasm (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005615 | extracellular space | IBA | 21873635 |
| GO:0005886 | plasma membrane | IEA | -- |
| GO:0016020 | membrane | TAS,HDA | 19946888 |
| GO:0016021 | integral component of membrane | IEA | -- |
| GO:0070062 | extracellular exosome | HDA | 19199708 |
Pathways & Interactions for CPD Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Clathrin derived vesicle budding | ||
| 2 | Vesicle-mediated transport | ||
Pathways by source for CPD Gene
5 Reactome pathways for CPD Gene
Interacting Proteins for CPD Gene
GPS-Prot Interaction Network for CPD
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006508 | proteolysis | IEA | -- |
| GO:0006518 | peptide metabolic process | IBA | 21873635 |
| GO:0016485 | protein processing | IBA | 21873635 |
No data available for SIGNOR curated interactions for CPD Gene
Drugs & Compounds for CPD Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Dexamethasone | Approved, Investigational, Vet_approved | Pharma | Agonist | Anti-inflammatory glucocorticoid | 2886 | |
| Dexamethasone acetate | Approved, Investigational, Vet_approved | Pharma | 2886 | |||
| Pomalidomide | Approved | Pharma | 180 | |||
| Zinc | Approved, Investigational | Pharma | 1594 | |||
| Guanidinoethylmercaptosuccinic acid | Experimental | Pharma | Target | 0 |
Transcripts for CPD Gene
mRNA/cDNA for CPD Gene
- 2 REFSEQ mRNAs :
- 14 NCBI additional mRNA sequence :
- 10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000225719 9372 nts (view in UCSC)
- ENST00000583275 415 nts (view in UCSC)
- ENST00000543464 4007 nts (view in UCSC)
- ENST00000581826 579 nts (view in UCSC)
- ENST00000584221 680 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for CPD - Select products 50% OFF >
- * CPD CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for CPD
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CPD
-
Santa Cruz Biotechnology (SCBT) CRISPR for CPD
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CPD
- Browse OriGene Inhibitory RNA Products For CPD
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CPD
Clone Products
- Applied Biological Materials (abm): Clones for CPD - Select products 50% OFF >
- * CPD as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for CPD
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CPD
Relevant External Links for CPD Gene
- GeneLoc Exon Structure for
- CPD
Expression for CPD Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Brain (Nervous System)
-
Blood (Hematopoietic System)
- Granulocytes Peripheral Blood
- Conventional Dendritic Cells I Spleen
-
Testis (Reproductive System)
- Testis Somatic Cells Primitive Gonad
- Testis Interstitium
- Neural Tube (Nervous System)
-
Gonad (Reproductive System)
- Testis Somatic Cells Primitive Gonad
- Spleen (Hematopoietic System)
- Gut Tube (Gastrointestinal Tract)
- Kidney (Urinary System)
- Bone (Muscoskeletal System)
- Thymus (Hematopoietic System)
- Eye (Sensory Organs)
-
Thyroid (Endocrine System)
mRNA differential expression in normal tissues according to GTEx for CPD Gene
This gene is overexpressed in Whole Blood (x5.9).
This gene is overexpressed in Salivary gland (21.6) and Oral epithelium (8.6).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for CPD Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for CPD
SOURCE GeneReport for Unigene cluster for CPD Gene:
Hs.446079mRNA Expression by UniProt/SwissProt for CPD Gene:
O75976-CBPD_HUMAN
Tissue specificity:
Highly expressed in placenta, pancreas and hepatoma cells. Lower levels found in skeletal muscle, heart and colon carcinoma and melanoma cell lines.
Evidence on tissue expression from TISSUES for CPD Gene
- Nervous system(4.8)
- Liver(4.6)
- Pancreas(2.6)
- Kidney(2.2)
- Heart(2)
Primer Products
-
OriGene qPCR primer pairs for CPD
-
OriGene qPCR primer pairs and template standards for CPD
Gene Expression Assay Products
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for CPD Gene
Orthologs for CPD Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | CPD 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | CPD 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | CPD 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Cpd 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Cpd 30 |
|
||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | CPD 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | CPD 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | CPD 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | -- 31 |
|
ManyToMany | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | LOC101730225 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | cpda 30 31 |
|
OneToMany | |
| cpdb 31 |
|
OneToMany | |||
| Fruit Fly (Drosophila melanogaster) |
Insecta | svr 30 31 32 |
|
OneToOne | |
| CG4678 32 |
|
|
|||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP002414 30 |
|
||
| Worm (Caenorhabditis elegans) |
Secernentea | cpd-2 30 31 |
|
ManyToMany | |
| F59A3.1 32 |
|
|
|||
| T27A8.1 32 |
|
|
|||
| F01D4.4 32 |
|
|
|||
| cpd-1 31 |
|
ManyToMany | |||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
OneToOne |
- Species where no ortholog for CPD was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for CPD Gene
- ENSEMBL:
- Gene Tree for CPD (if available)
- TreeFam:
- Gene Tree for CPD (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for CPD: view image
Paralogs for CPD Gene
(3) SIMAP similar genes for CPD Gene using alignment to 4 proteins:
- CBPD_HUMAN
- J3QQJ4_HUMAN
- J3QRJ9_HUMAN
- K7ELF0_HUMAN
Pseudogenes.org Pseudogenes for CPD Gene
Variants for CPD Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for CPD Gene
| SNP ID | Clinical significance and condition | Chr 17 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 739309 | Benign: not provided | 30,445,843(+) | C/T | MISSENSE_VARIANT | |
| 770445 | Benign: not provided | 30,422,862(+) | A/G | MISSENSE_VARIANT | |
| 778687 | Benign: not provided | 30,378,993(+) | C/A | SYNONYMOUS_VARIANT | |
| 791199 | Benign: not provided | 30,431,785(+) | T/G | SYNONYMOUS_VARIANT | |
| rs17854355 | - | p.His505Asn |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2673490 | CNV | deletion | 23128226 |
| esv3554304 | CNV | deletion | 23714750 |
| nsv1064611 | CNV | gain | 25217958 |
| nsv515870 | CNV | gain | 19592680 |
Residual Variation Intolerance Score:
13.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.27;
62.55% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for CPD Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CPD Gene
Disorders for CPD Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| hepatitis b |
|
|
| hepatitis |
|
|
Search CPD in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for CPD
No data available for UniProtKB/Swiss-Prot and Genatlas for CPD Gene
Publications for CPD Gene
- Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains. (PMID: 9355738) Tan F … Skidgel RA (The Biochemical journal 1997) 2 3 4 23
- Palmitoylation of carboxypeptidase D. Implications for intracellular trafficking. (PMID: 12643288) Kalinina EV … Fricker LD (The Journal of biological chemistry 2003) 3 4 23
- Cloning, functional expression, and chromosomal localization of the human and mouse gp180-carboxypeptidase D-like enzyme. (PMID: 9714835) Ishikawa T … Kuroki K (Gene 1998) 3 4 23
- Chromosomal localization of the genes for human carboxypeptidase D (CPD) and the active 50-kilodalton subunit of human carboxypeptidase N (CPN1). (PMID: 9628828) Riley DA … Skidgel RA (Genomics 1998) 2 3 23
- Identification of a membrane-bound carboxypeptidase as the mammalian homolog of duck gp180, a hepatitis B virus-binding protein. (PMID: 9064476) McGwire GB … Skidgel RA (Life sciences 1997) 3 4 23
ExternalLinks
Products for CPD Gene
- Custom Antibody ServicesOriGene Antibodies for CPD
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for CPD
- Origene Custom Protein Services for CPD
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CPD
- Browse OriGene Inhibitory RNA Products For CPD
- OriGene qPCR primer pairs for CPD
- OriGene qPCR primer pairs and template standards for CPD
- OriGene CRISPR knockouts for CPD
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CPD
- Sino Biological Human cDNA Clone for CPD
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for CPD
- Novus Biologicals proteins for CPD
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for CPD
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for CPD
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for CPD (AFLGC-CPD)
- VectorBuilder Custom and pre-made DNA vectors for CPD (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for CPD (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for CPD (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for CPD CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for CPD
- antibodies-online: Show 130 available CPD Antibodies ranked by validation data
- Compare Top CPD Antibodies
- antibodies-online: Show 4 available CPD Elisa Kits ranked by validation data
- Compare Top CPD Elisa Kits
- Quality Products:
- antibodies-online: Show 5 available CPD Proteins ranked by validation data
- Compare Top CPD Proteins
- Horizon Cell Lines for CPD
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CPD
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CPD
- Search GeneCopoeia for miRNA 3'UTR Target clone products for CPD
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CPD
- Boster Bio Antibodies for CPD
- Browse Boster Bio ELISA Kits
Sources for CPD Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB