Free for academic non-profit institutions. Other users need a Commercial license
This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity.[provided by RefSeq, Feb 2011] See more...
Aliases for CHST10 Gene
Aliases for CHST10 Gene
External Ids for CHST10 Gene
- HGNC: 19650
- NCBI Entrez Gene: 9486
- Ensembl: ENSG00000115526
- OMIM®: 606376
- UniProtKB/Swiss-Prot: O43529
Previous GeneCards Identifiers for CHST10 Gene
- GC02M099461
- GC02M100612
- GC02M100629
- GC02M100466
- GC02M101008
- GC02M094773
Summaries for CHST10 Gene
-
This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity.[provided by RefSeq, Feb 2011]
GeneCards Summary for CHST10 Gene
CHST10 (Carbohydrate Sulfotransferase 10) is a Protein Coding gene. Diseases associated with CHST10 include Retinitis Pigmentosa 33 and Colon Lymphoma. Among its related pathways are Articular Cartilage Extracellular Matrix Pathway and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include sulfotransferase activity and HNK-1 sulfotransferase activity. An important paralog of this gene is CHST9.
UniProtKB/Swiss-Prot Summary for CHST10 Gene
-
Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.
Additional gene information for CHST10 Gene
- HGNC (19650)
- NCBI Entrez Gene (9486)
- Ensembl (ENSG00000115526)
- OMIM® (606376)
- UniProtKB/Swiss-Prot (O43529)
- Open Targets Platform(ENSG00000115526)
- Search for CHST10 at DataMed
- Search for CHST10 at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for CHST10 Gene
Genomics for CHST10 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for CHST10 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around CHST10 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for CHST10
- Top Transcription factor binding sites by QIAGEN in the CHST10 gene promoter:
-
- aMEF-2
- AML1a
- Cdc5
- CUTL1
- HNF-3beta
- MEF-2
- MEF-2A
- RORalpha1
- TBP
Genomic Locations for CHST10 Gene
Latest Assembly
- chr2:100,391,860-100,417,668
- (GRCh38/hg38)
- Size:
- 25,809 bases
- Orientation:
- Minus strand
Previous Assembly
- chr2:101,008,322-101,034,130
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 25,809 bases
- Orientation:
- Minus strand
- chr2:101,008,327-101,034,118
- (GRCh37/hg19 by Ensembl)
- Size:
- 25,792 bases
- Orientation:
- Minus strand
Genomic View for CHST10 Gene
Genes around CHST10 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 2q11.2 by HGNC
- 2q11.2 by Entrez Gene
- 2q11.2 by Ensembl
CHST10 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CHST10 Gene
Proteins for CHST10 Gene
-
Protein details for CHST10 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O43529-CHSTA_HUMAN
- Recommended name:
- Carbohydrate sulfotransferase 10
- Protein Accession:
- O43529
- Q53T18
Protein attributes for CHST10 Gene
- Size:
- 356 amino acids
- Molecular mass:
- 42207 Da
- Quaternary structure:
- No Data Available
Protein Expression for CHST10 Gene
Selected DME Specific Peptides for CHST10 Gene
- O43529:
-
- KFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNG
- DFKLFGY
- NGLPRLSS
- GHHETLE
- NPRFEPWY
- YNRTKVE
- QFGDHIIHW
- LCAPCEI
- YFKFFIVRDPFERLISAFKDKFV
Post-translational modifications for CHST10 Gene
Other Protein References for CHST10 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- G Biosciences Immunotag™ CHST10 Antibody
-
Custom Antibody ServicesOriGene Antibodies for CHST10
- Novus Biologicals Antibodies for CHST10
- Invitrogen Antibodies for CHST10 (AFLGC-CHST10)
-
Custom Antibody ServicesProSci Antibodies for CHST10
- Sino Biological Antibodies for CHST10
Protein products for research
- Search Origene for MassSpec and Protein Over-expression Lysates for CHST10
- Origene Custom Protein Services for CHST10
- ProSpec Recombinant Proteins for CHST10
-
Abcam proteins for CHST10
Assay products for research
Domains & Families for CHST10 Gene
Gene Families for CHST10 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for CHST10 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for CHST10 Gene
- GenScript: Design optimal peptide antigens:
-
- HNK-1 sulfotransferase (CHSTA_HUMAN)
- cDNA, FLJ93746, Homo sapiens carbohydrate sulfotransferase 10 (CHST10), mRNA (Q53T18_HUMAN)
Graphical View of Domain Structure for InterPro Entry
O43529- Family:
-
- Belongs to the sulfotransferase 2 family.
Function for CHST10 Gene
Molecular function for CHST10 Gene
- UniProtKB/Swiss-Prot Function:
- Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.
Enzyme Numbers (IUBMB) for CHST10 Gene
Phenotypes From GWAS Catalog for CHST10 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0008146 | sulfotransferase activity | IEA,IBA | 21873635 |
| GO:0016232 | HNK-1 sulfotransferase activity | TAS | -- |
| GO:0016740 | transferase activity | IEA | -- |
Phenotypes for CHST10 Gene
- MGI mutant phenotypes for CHST10:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for CHST10:
Animal Models for CHST10 Gene
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for CHST10 - Starting at $85 >
- * CHST10 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for CHST10
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CHST10
-
Santa Cruz Biotechnology (SCBT) CRISPR for CHST10
miRNA for CHST10 Gene
- miRTarBase miRNAs that target CHST10
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CHST10
Clone products for research
- Applied Biological Materials (abm): Clones for CHST10 - Starting at $45 >
- * CHST10 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for CHST10
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CHST10
Cell Lines for research
-
Horizon Cell Lines for CHST10
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CHST10 Gene
Localization for CHST10 Gene
Subcellular locations from UniProtKB/Swiss-Prot for CHST10 Gene
- Golgi apparatus membrane. Single-pass type II membrane protein.
| Compartment | Confidence |
|---|---|
| golgi apparatus | 5 |
| extracellular | 3 |
| cytosol | 2 |
| plasma membrane | 1 |
| cytoskeleton | 1 |
| nucleus | 1 |
| endoplasmic reticulum | 1 |
| peroxisome | 0 |
- Cytosol (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | IEA,TAS | -- |
| GO:0005794 | Golgi apparatus | IEA,TAS | 9478973 |
| GO:0016020 | membrane | IEA,TAS | 9478973 |
| GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for CHST10 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Transport to the Golgi and subsequent modification | ||
| 2 | Metabolism of proteins | ||
| 3 | N-glycan antennae elongation in the medial/trans-Golgi | ||
| 4 | Mannose type O-glycan biosynthesis | ||
| 5 | Metabolism | ||
Pathways by source for CHST10 Gene
1 BioSystems pathway for CHST10 Gene
2 KEGG pathways for CHST10 Gene
1 R&D Systems pathway for CHST10 Gene
Interacting Proteins for CHST10 Gene
GPS-Prot Interaction Network for CHST10
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005975 | carbohydrate metabolic process | IEA | -- |
| GO:0007155 | cell adhesion | TAS | 9478973 |
| GO:0016051 | carbohydrate biosynthetic process | IEA | -- |
| GO:0030166 | proteoglycan biosynthetic process | IBA | 21873635 |
No data available for SIGNOR curated interactions for CHST10 Gene
Transcripts for CHST10 Gene
mRNA/cDNA for CHST10 Gene
- 1 REFSEQ mRNAs :
- 10 NCBI additional mRNA sequence :
- 12 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000264249 2854 nts (view in UCSC)
- ENST00000409046 604 nts (view in UCSC)
- ENST00000409701 1338 nts (view in UCSC)
- ENST00000418201 692 nts (view in UCSC)
- ENST00000420858 574 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for CHST10 - Starting at $85 >
- * CHST10 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for CHST10
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CHST10
-
Santa Cruz Biotechnology (SCBT) CRISPR for CHST10
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CHST10
Clone products for research
- Applied Biological Materials (abm): Clones for CHST10 - Starting at $45 >
- * CHST10 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for CHST10
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CHST10
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | · | 1f | ^ | 2a | · | 2b | · | 2c | ^ | 3a | · | 3b | · | 3c | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12a | · | 12b | · | 12c | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP11: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: |
| ExUns: | 12d | ^ | 13a | · | 13b | ^ | 14a | · | 14b |
|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||
| SP2: | |||||||||
| SP3: | |||||||||
| SP4: | |||||||||
| SP5: | |||||||||
| SP6: | |||||||||
| SP7: | |||||||||
| SP8: | |||||||||
| SP9: | |||||||||
| SP10: | |||||||||
| SP11: | |||||||||
| SP12: | |||||||||
| SP13: |
Relevant External Links for CHST10 Gene
- GeneLoc Exon Structure for
- CHST10
Expression for CHST10 Gene
This gene is overexpressed in Vitreous humor (67.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for CHST10 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for CHST10
SOURCE GeneReport for Unigene cluster for CHST10 Gene:
Hs.516370mRNA Expression by UniProt/SwissProt for CHST10 Gene:
O43529-CHSTA_HUMAN
Tissue specificity:
In fetal tissues, it is predominantly expressed in brain, and weakly expressed in lung, kidney and liver. In adult, it is highly expressed in brain, testis, ovary, expressed at intermediate level in heart, pancreas, skeletal muscle, spleen and thymus, and weakly expressed in other tissues. In brain, it is expressed at higher level in the frontal lobe.
Evidence on tissue expression from TISSUES for CHST10 Gene
- Nervous system(4.7)
- Heart(2.4)
Primer products for research
-
OriGene qPCR primer pairs for CHST10
-
OriGene qPCR primer pairs and template standards for CHST10
Gene Expression Assays for research
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CHST10 Gene
Orthologs for CHST10 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | CHST10 30 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | -- 31 |
|
OneToMany | |
| -- 31 |
|
OneToMany | |||
| Dog (Canis familiaris) |
Mammalia | CHST10 30 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Chst10 30 |
|
||
| Mouse (Mus musculus) |
Mammalia | Chst10 30 17 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | CHST10 30 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | CHST10 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | CHST10 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | CHST10 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | chst10 30 |
|
||
| Str.16232 30 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.8239 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | chst10 30 31 |
|
OneToOne | |
| Dr.11834 30 |
|
||||
| Fruit Fly (Drosophila melanogaster) |
Insecta | CG14024 31 |
|
ManyToMany | |
| CG13937 31 |
|
ManyToMany | |||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
ManyToMany | |
| -- 31 |
|
ManyToMany | |||
| -- 31 |
|
ManyToMany | |||
| -- 31 |
|
ManyToMany | |||
| -- 31 |
|
ManyToMany |
- Species where no ortholog for CHST10 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for CHST10 Gene
- ENSEMBL:
- Gene Tree for CHST10 (if available)
- TreeFam:
- Gene Tree for CHST10 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for CHST10: view image
Paralogs for CHST10 Gene
(4) SIMAP similar genes for CHST10 Gene using alignment to 8 proteins:
- CHSTA_HUMAN
- B8ZZ48_HUMAN
- C9J5X0_HUMAN
- C9JCK7_HUMAN
- C9JI33_HUMAN
- C9JUE4_HUMAN
- C9JWY0_HUMAN
- F5H3J3_HUMAN
Variants for CHST10 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for CHST10 Gene
| SNP ID | Clinical significance and condition | Chr 02 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs35177621 | - |
p.Val20Leu |
|||
| rs3748932 | - |
p.Asp258Asn |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
Residual Variation Intolerance Score:
73.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
8.49;
85.84% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for CHST10 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- CHST10
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CHST10 Gene
Disorders for CHST10 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| retinitis pigmentosa 33 |
|
|
| colon lymphoma |
|
|
| walker-warburg syndrome |
|
|
Search CHST10 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for CHST10
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for CHST10 Gene
Publications for CHST10 Gene
- Molecular cloning and characterization of chondroitin-4-O-sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases. (PMID: 12080076) Kang HG … Schachner M (The Journal of biological chemistry 2002) 2 3 23
- Structure and function of HNK-1 sulfotransferase. Identification of donor and acceptor binding sites by site-directed mutagenesis. (PMID: 10464296) Ong E … Fukuda M (The Journal of biological chemistry 1999) 3 4 23
- Expression cloning of a human sulfotransferase that directs the synthesis of the HNK-1 glycan on the neural cell adhesion molecule and glycolipids. (PMID: 9478973) Ong E … Fukuda M (The Journal of biological chemistry 1998) 3 4 23
- Mechanism of regulation and suppression of melanoma invasiveness by novel retinoic acid receptor-gamma target gene carbohydrate sulfotransferase 10. (PMID: 19470764) Zhao X … Spanjaard RA (Cancer research 2009) 3 23
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
ExternalLinks
Products for CHST10 Gene
- Custom Antibody ServicesOriGene Antibodies for CHST10
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for CHST10
- Origene Custom Protein Services for CHST10
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- OriGene qPCR primer pairs for CHST10
- OriGene qPCR primer pairs and template standards for CHST10
- OriGene CRISPR knockouts for CHST10
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CHST10
- Sino Biological Human cDNA Clone for CHST10
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for CHST10
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for CHST10
- Novus Biologicals proteins and lysates for CHST10
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam proteins for CHST10
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- VectorBuilder Custom and pre-made DNA vectors for CHST10 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for CHST10 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for CHST10 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for CHST10 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for CHST10
- antibodies-online: Show 14 available CHST10 Antibodies ranked by validation data
- Compare Top CHST10 Antibodies
- antibodies-online: Search results for available CHST10 related products ranked by validation data
- antibodies-online: Show 12 available CHST10 Proteins ranked by validation data
- Compare Top CHST10 Proteins
- Quality Products:
- Custom Antibody ServicesProSci Antibodies for CHST10
- Search for CHST10 Proteins at ProSci
- Horizon Cell Lines for CHST10
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CHST10
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CHST10
- Search GeneCopoeia for miRNA 3'UTR Target clone products for CHST10
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CHST10
Sources for CHST10 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Mar-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) MedlinePlus Genetics
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNAcentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Open Targets Platform
- (175) 5SRRNADB
- (176) snoDB
- (177) MirGeneDB