Free for academic non-profit institutions. Other users need a Commercial license

Aliases for CBLB Gene

Aliases for CBLB Gene

  • Cbl Proto-Oncogene B 2 3 5
  • Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence B 2 3
  • Cbl Proto-Oncogene B, E3 Ubiquitin Protein Ligase 2 3
  • Casitas B-Lineage Lymphoma Proto-Oncogene B 3 4
  • RING-Type E3 Ubiquitin Transferase CBL-B 3 4
  • Signal Transduction Protein CBL-B 3 4
  • SH3-Binding Protein CBL-B 3 4
  • RING Finger Protein 56 3 4
  • RNF56 3 4
  • Cas-Br-M (Murine) Ectropic Retroviral Transforming Sequence B 2
  • Cbl Proto-Oncogene, E3 Ubiquitin Protein Ligase B 3
  • E3 Ubiquitin-Protein Ligase CBL-B 3
  • EC 2.3.2.27 4
  • Nbla00127 3
  • EC 6.3.2 56
  • Cbl-B 3

External Ids for CBLB Gene

Previous GeneCards Identifiers for CBLB Gene

  • GC03M102013
  • GC03M104895
  • GC03M106658
  • GC03M106698
  • GC03M106859
  • GC03M105374
  • GC03M102751

Summaries for CBLB Gene

Entrez Gene Summary for CBLB Gene

  • This gene encodes an E3 ubiquitin-protein ligase which promotes proteosome-mediated protein degradation by transferring ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate. The encoded protein is involved in the regulation of immune response by limiting T-cell receptor, B-cell receptor, and high affinity immunoglobulin epsilon receptor activation. Studies in mouse suggest that this gene is involved in antifungal host defense and that its inhibition leads to increased fungal killing. Manipulation of this gene may be beneficial in implementing immunotherapies for a variety of conditions, including cancer, autoimmune diseases, allergies, and infections. [provided by RefSeq, Sep 2017]

CIViC summary for CBLB Gene

GeneCards Summary for CBLB Gene

CBLB (Cbl Proto-Oncogene B) is a Protein Coding gene. Among its related pathways are Chronic myeloid leukemia and Innate Immune System. Gene Ontology (GO) annotations related to this gene include calcium ion binding and ubiquitin-protein transferase activity. An important paralog of this gene is CBL.

UniProtKB/Swiss-Prot for CBLB Gene

  • E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. Slightly promotes SRC ubiquitination. May be involved in EGFR ubiquitination and internalization. May be functionally coupled with the E2 ubiquitin-protein ligase UB2D3.

Gene Wiki entry for CBLB Gene

Additional gene information for CBLB Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CBLB Gene

Genomics for CBLB Gene

GeneHancer (GH) Regulatory Elements for CBLB Gene

Promoters and enhancers for CBLB Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH03I105865 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE dbSUPER 562 +1.3 1307 5.8 HDGF PKNOX1 FOXA2 SMAD1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 ZBTB7B CBLB GC03P105856
GH03I105826 Enhancer 1.4 FANTOM5 Ensembl ENCODE dbSUPER 28.5 +40.3 40308 5.2 PKNOX1 SMAD1 MZF1 BMI1 BATF IRF4 RAD21 ZNF207 ATF7 FOS CBLB GC03M105835 GC03P105761
GH03I105361 Promoter/Enhancer 2.8 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 10.9 +503.4 503353 9.7 CLOCK FOXA2 SMAD1 ARID4B SIN3A DMAP1 IRF4 YY1 ZNF213 ZNF207 ALCAM GC03P105365 CBLB
GH03I105805 Enhancer 1.2 Ensembl ENCODE dbSUPER 21 +63.2 63204 1 JUN EBF1 BATF RAD21 RFX5 FOSL1 POLR2A NFATC1 ATF7 FOSL2 CBLB GC03M105835 GC03P105761
GH03I105798 Enhancer 1.1 Ensembl ENCODE dbSUPER 20.1 +70.8 70750 0.9 PKNOX1 CEBPG BMI1 BATF ATF7 RCOR1 ETV6 IKZF2 RUNX3 JUNB CBLB GC03M105835 GC03P105761
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around CBLB on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the CBLB gene promoter:

Genomic Locations for CBLB Gene

Genomic Locations for CBLB Gene
chr3:105,655,461-105,869,552
(GRCh38/hg38)
Size:
214,092 bases
Orientation:
Minus strand
chr3:105,374,305-105,588,396
(GRCh37/hg19)

Genomic View for CBLB Gene

Genes around CBLB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CBLB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CBLB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CBLB Gene

Proteins for CBLB Gene

  • Protein details for CBLB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13191-CBLB_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase CBL-B
    Protein Accession:
    Q13191
    Secondary Accessions:
    • A8K9S7
    • B7WNM4
    • Q13192
    • Q13193
    • Q3LIC0
    • Q63Z43
    • Q8IVC5

    Protein attributes for CBLB Gene

    Size:
    982 amino acids
    Molecular mass:
    109450 Da
    Quaternary structure:
    • Interacts with SH3 domain-containing proteins LCK, CRK and SORBS1. Interacts with LCP2 and ZAP70. May interact with CBL. Interacts with SH3 domain-containing proteins VAV1, FYN, FGR, PLCG1, GRB2, CRKL, PIK3R1 and SH3KBP1/CIN85. Identified in heterotrimeric complexes with SH3KBP1/CIN85, CD2AP and ARHGEF7, where one CBLB peptide binds two copies of the other protein. Interacts with poly-ubiquitinated proteins. Dimerization is required for the binding of poly-ubiquitin, but not for the binding of mono-ubiquitin. Interacts with EGFR (phosphorylated).
    Miscellaneous:
    • This protein has one functional calcium-binding site.
    SequenceCaution:
    • Sequence=BAE45748.1; Type=Erroneous termination; Positions=904; Note=Translated as Arg.; Evidence={ECO:0000305}; Sequence=CAH56175.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for CBLB Gene

    Alternative splice isoforms for CBLB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CBLB Gene

Selected DME Specific Peptides for CBLB Gene

Q13191:
  • LAVTHPGYMAFLTYDEVKARLQK
  • NPDLTGLCEPTP
  • VARSILREFAFPPPV
  • LKNSPPYILD
  • PLQIPHL
  • LPDTYQHLR
  • PRRTAPEIHHR
  • GNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLT
  • QAPARPPKP
  • FRITKADAAEFWRK
  • KPGSYIFRLSCTRLGQWAIGYVT
  • FRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDI
  • WKLMDKVVRLCQNPKL
  • PPPPPERPPPIPPD
  • RRNLTKLSLIFSHMLAE
  • ENVDAKIAKLMGEG
  • LFKEGKERMYEE

Post-translational modifications for CBLB Gene

  • Auto-ubiquitinated upon EGF-mediated cell activation or upon T-cell costimulation by CD28; which promotes proteasomal degradation.
  • Phosphorylated on tyrosine and serine residues upon TCR or BCR activation, and upon various types of cell stimulation.
  • Ubiquitination at posLast=9797 and posLast=516516

Domains & Families for CBLB Gene

Gene Families for CBLB Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

Q13191

UniProtKB/Swiss-Prot:

CBLB_HUMAN :
  • The N-terminus is composed of the phosphotyrosine binding (PTB) domain, a short linker region and the RING-type zinc finger. The PTB domain, which is also called TKB (tyrosine kinase binding) domain, is composed of three different subdomains: a four-helix bundle (4H), a calcium-binding EF hand and a divergent SH2 domain.
Domain:
  • The N-terminus is composed of the phosphotyrosine binding (PTB) domain, a short linker region and the RING-type zinc finger. The PTB domain, which is also called TKB (tyrosine kinase binding) domain, is composed of three different subdomains: a four-helix bundle (4H), a calcium-binding EF hand and a divergent SH2 domain.
  • The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
  • The UBA domain interacts with poly-ubiquitinated proteins.
genes like me logo Genes that share domains with CBLB: view

Function for CBLB Gene

Molecular function for CBLB Gene

GENATLAS Biochemistry:
protein (109kDa),homolog to the proto-oncogene v-cbl,expressed in a variety of normal tissues,potentially interacting with signal transduction molecules,regulating in mouse,the CD28 dependence of T cell activation and putatively contributing to autoimmune diseases
UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. Slightly promotes SRC ubiquitination. May be involved in EGFR ubiquitination and internalization. May be functionally coupled with the E2 ubiquitin-protein ligase UB2D3.

Enzyme Numbers (IUBMB) for CBLB Gene

Phenotypes From GWAS Catalog for CBLB Gene

Gene Ontology (GO) - Molecular Function for CBLB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001784 phosphotyrosine residue binding IEA --
GO:0004842 ubiquitin-protein transferase activity IEA --
GO:0004871 signal transducer activity IEA --
GO:0005509 calcium ion binding IEA --
GO:0005515 protein binding IPI 10022120
genes like me logo Genes that share ontologies with CBLB: view
genes like me logo Genes that share phenotypes with CBLB: view

Animal Models for CBLB Gene

MGI Knock Outs for CBLB:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for CBLB

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CBLB Gene

Localization for CBLB Gene

Subcellular locations from UniProtKB/Swiss-Prot for CBLB Gene

Cytoplasm. Note=Upon EGF stimulation, associates with endocytic vesicles.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CBLB gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 3

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for CBLB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane TAS,IBA --
genes like me logo Genes that share ontologies with CBLB: view

Pathways & Interactions for CBLB Gene

genes like me logo Genes that share pathways with CBLB: view

UniProtKB/Swiss-Prot Q13191-CBLB_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for CBLB Gene

Inactivates:
Is inactivated by:

Gene Ontology (GO) - Biological Process for CBLB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IBA --
GO:0006607 NLS-bearing protein import into nucleus TAS 7784085
GO:0007165 signal transduction TAS 7784085
GO:0007166 cell surface receptor signaling pathway IEA --
GO:0007173 epidermal growth factor receptor signaling pathway IBA --
genes like me logo Genes that share ontologies with CBLB: view

Drugs & Compounds for CBLB Gene

(4) Drugs for CBLB Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
calcium Approved Nutra 0

(2) Additional Compounds for CBLB Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with CBLB: view

Transcripts for CBLB Gene

Unigene Clusters for CBLB Gene

Cbl proto-oncogene, E3 ubiquitin protein ligase B:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for CBLB

Alternative Splicing Database (ASD) splice patterns (SP) for CBLB Gene

ExUns: 1 ^ 2a · 2b · 2c · 2d · 2e ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18a ·
SP1: - -
SP2: - -
SP3: - -
SP4: - - - - - - - - - - - - - - - -
SP5: -
SP6: - -
SP7:
SP8: -
SP9: - - - - -
SP10:

ExUns: 18b ^ 19a · 19b ^ 20 ^ 21a · 21b ^ 22
SP1: - -
SP2:
SP3:
SP4: - -
SP5: - - -
SP6:
SP7: - - -
SP8:
SP9:
SP10:

Relevant External Links for CBLB Gene

GeneLoc Exon Structure for
CBLB
ECgene alternative splicing isoforms for
CBLB

Expression for CBLB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for CBLB Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for CBLB Gene

This gene is overexpressed in Peripheral blood mononuclear cells (23.7), CD8 Tcells (21.3), and Adrenal (12.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CBLB Gene



Protein tissue co-expression partners for CBLB Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of CBLB Gene:

CBLB

SOURCE GeneReport for Unigene cluster for CBLB Gene:

Hs.430589

mRNA Expression by UniProt/SwissProt for CBLB Gene:

Q13191-CBLB_HUMAN
Tissue specificity: Expressed in placenta, heart, lung, kidney, spleen, ovary and testis, as well as fetal brain and liver and hematopoietic cell lines, but not in adult brain, liver, pancreas, salivary gland, or skeletal muscle. Present in lymphocytes (at protein level).

Evidence on tissue expression from TISSUES for CBLB Gene

  • Intestine(4.2)
  • Nervous system(2.9)
genes like me logo Genes that share expression patterns with CBLB: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CBLB Gene

Orthologs for CBLB Gene

This gene was present in the common ancestor of animals.

Orthologs for CBLB Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CBLB 33 34
  • 99.56 (n)
oppossum
(Monodelphis domestica)
Mammalia CBLB 34
  • 92 (a)
OneToOne
cow
(Bos Taurus)
Mammalia CBLB 33 34
  • 91.92 (n)
dog
(Canis familiaris)
Mammalia CBLB 33 34
  • 91.48 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia CBLB 34
  • 90 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Cblb 33
  • 87.76 (n)
mouse
(Mus musculus)
Mammalia Cblb 33 16 34
  • 87.62 (n)
chicken
(Gallus gallus)
Aves CBLB 33 34
  • 79.87 (n)
lizard
(Anolis carolinensis)
Reptilia CBLB 34
  • 83 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia cblb 33
  • 73.77 (n)
zebrafish
(Danio rerio)
Actinopterygii cblb 33 34
  • 65.17 (n)
fruit fly
(Drosophila melanogaster)
Insecta Cbl 35 34
  • 72 (a)
worm
(Caenorhabditis elegans)
Secernentea sli-1 35 34
  • 56 (a)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 66 (a)
OneToMany
Species where no ortholog for CBLB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for CBLB Gene

ENSEMBL:
Gene Tree for CBLB (if available)
TreeFam:
Gene Tree for CBLB (if available)

Paralogs for CBLB Gene

Paralogs for CBLB Gene

(3) SIMAP similar genes for CBLB Gene using alignment to 7 proteins:

genes like me logo Genes that share paralogs with CBLB: view

Variants for CBLB Gene

Sequence variations from dbSNP and Humsavar for CBLB Gene

SNP ID Clin Chr 03 pos Variation AA Info Type
rs114461789 not-provided, not specified 105,720,076(-) T/C coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs116474782 not-provided, not specified 105,720,150(-) C/T 5_prime_UTR_variant, coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs148064625 not-provided, not specified 105,702,383(-) G/A coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs35835913 not-provided, not specified 105,670,275(-) T/C coding_sequence_variant, genic_downstream_transcript_variant, missense_variant, non_coding_transcript_variant
rs41302192 not-provided, not specified 105,702,188(-) C/G/T coding_sequence_variant, missense_variant, non_coding_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for CBLB Gene

Variant ID Type Subtype PubMed ID
nsv829651 CNV loss 17160897
nsv591242 CNV loss 21841781
nsv525071 CNV gain 19592680
nsv511097 OTHER complex 20534489
nsv508234 CNV deletion 20534489
esv3575591 CNV gain 25503493
dgv8496n54 CNV loss 21841781
dgv8495n54 CNV loss 21841781
dgv4833n100 CNV gain 25217958

Variation tolerance for CBLB Gene

Residual Variation Intolerance Score: 5.51% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.88; 59.04% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for CBLB Gene

Human Gene Mutation Database (HGMD)
CBLB
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CBLB

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CBLB Gene

Disorders for CBLB Gene

Additional Disease Information for CBLB

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for CBLB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for CBLB Gene

Publications for CBLB Gene

  1. Cloning and characterization of cbl-b: a SH3 binding protein with homology to the c-cbl proto-oncogene. (PMID: 7784085) Keane MM … Lipkowitz S (Oncogene 1995) 2 3 4 22 58
  2. Cbl promotes clustering of endocytic adaptor proteins. (PMID: 16228008) Jozic D … Bravo J (Nature structural & molecular biology 2005) 3 4 22 58
  3. CBLB variants in type 1 diabetes and their genetic interaction with CTLA4. (PMID: 15629882) Bergholdt R … Pociot F (Journal of leukocyte biology 2005) 3 22 44 58
  4. Cbl-b interacts with ubiquitinated proteins; differential functions of the UBA domains of c-Cbl and Cbl-b. (PMID: 15273720) Davies GC … Lipkowitz S (Oncogene 2004) 3 4 22 58
  5. Cbl-c suppresses v-Src-induced transformation through ubiquitin-dependent protein degradation. (PMID: 14661060) Kim M … Yamamoto T (Oncogene 2004) 3 4 22 58

Products for CBLB Gene

  • Addgene plasmids for CBLB

Sources for CBLB Gene

Content
Loading form....