Free for academic non-profit institutions. Other users need a Commercial license
This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldos... See more...
Aliases for CAMK1D Gene
Aliases for CAMK1D Gene
External Ids for CAMK1D Gene
- HGNC: 19341
- Entrez Gene: 57118
- Ensembl: ENSG00000183049
- OMIM: 607957
- UniProtKB: Q8IU85
Previous GeneCards Identifiers for CAMK1D Gene
- GC10P012395
- GC10P012431
- GC10P012391
Summaries for CAMK1D Gene
-
This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015]
GeneCards Summary for CAMK1D Gene
CAMK1D (Calcium/Calmodulin Dependent Protein Kinase ID) is a Protein Coding gene. Diseases associated with CAMK1D include Ceroid Lipofuscinosis, Neuronal, 6 and Maturity-Onset Diabetes Of The Young. Among its related pathways are Neuroscience and B Cell Receptor Signaling Pathway (sino). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CAMK1.
UniProtKB/Swiss-Prot Summary for CAMK1D Gene
-
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Activates the transcription factor CREB1 in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta.
Additional gene information for CAMK1D Gene
- HGNC(19341)
- Entrez Gene(57118)
- Ensembl(ENSG00000183049)
- OMIM(607957)
- UniProtKB(Q8IU85)
- Open Targets Platform(ENSG00000183049)
- Monarch Initiative
- Search for CAMK1D at DataMed
- Search for CAMK1D at HumanCyc
No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for CAMK1D Gene
Genomics for CAMK1D Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for CAMK1D Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around CAMK1D on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for CAMK1D
- Top Transcription factor binding sites by QIAGEN in the CAMK1D gene promoter:
-
- AP-1
- AREB6
- c-Fos
- Egr-4
- FosB
- HOXA3
- HOXA5
- HSF2
- Max1
- Pax-5
Genomic Locations for CAMK1D Gene
Genomic Locations for CAMK1D Gene
- chr10:12,349,482-12,835,545
- (GRCh38/hg38)
- Size:
- 486,064 bases
- Orientation:
- Plus strand
- chr10:12,391,481-12,877,545
- (GRCh37/hg19)
- Size:
- 486,065 bases
- Orientation:
- Plus strand
Genomic View for CAMK1D Gene
Genes around CAMK1D on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 10p13 by HGNC
- 10p13 by Entrez Gene
- 10p13 by Ensembl
CAMK1D Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CAMK1D Gene
Proteins for CAMK1D Gene
-
Protein details for CAMK1D Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q8IU85-KCC1D_HUMAN
- Recommended name:
- Calcium/calmodulin-dependent protein kinase type 1D
- Protein Accession:
- Q8IU85
- B0YIY0
- Q9HD31
Protein attributes for CAMK1D Gene
- Size:
- 385 amino acids
- Molecular mass:
- 42914 Da
- Quaternary structure:
- No Data Available
Three dimensional structures from OCA and Proteopedia for CAMK1D Gene
Protein Expression for CAMK1D Gene
Selected DME Specific Peptides for CAMK1D Gene
- Q8IU85:
-
- KCIPKKAL
- QAFNATAVVRHMR
- KLFEQILKAEYEFDSPYWDDISDSAKDFIR
- STACGTPGYVAPEVLAQKPYSKAVDCWSIGVI
- KNFAKSKW
- GGELFDR
- SKIMISDFGLSKME
- ENEIAVL
- ISDSAKD
- YVAPEVL
- LKPENLL
- RDLKPEN
- VHRDLKP
- MQLVSGGELFDRI
- IVHRDLK
Post-translational modifications for CAMK1D Gene
Other Protein References for CAMK1D Gene
Antibody Products
- LifeSpan BioSciences CAMK1D Monoclonal Antibody
-
Custom Antibody ServicesOriGene Antibodies for CAMK1D
- Novus Biologicals Antibodies for CAMK1D
-
Abcam antibodies for CAMK1D
- Invitrogen Antibodies for CAMK1D (AFLGC-CAMK1D)
-
Boster Bio Antibodies for CAMK1D
-
Santa Cruz Biotechnology (SCBT) Antibodies for CAMK1D
Protein Products
- Search Origene for MassSpec and Protein Over-expression Lysates for CAMK1D
- Origene Custom Protein Services for CAMK1D
- Sino Biological Cell Lysates for CAMK1D
- Sino Biological Recombinant Proteins for CAMK1D
-
ProSci Proteins for CAMK1D
-
Abcam proteins for CAMK1D
Assay Products
- antibodies-online: Show 2 available CAMK1D Elisa Kits ranked by validation data
- Compare Top CAMK1D Elisa Kits
-
Quality Products:
Domains & Families for CAMK1D Gene
Gene Families for CAMK1D Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted membrane proteins
Protein Domains for CAMK1D Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for CAMK1D Gene
- GenScript: Design optimal peptide antigens:
-
- CaMKI-like protein kinase (KCC1D_HUMAN)
- cDNA FLJ76987, highly similar to Homo sapiens calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1, mRNA (Q5SQQ7_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q8IU85UniProtKB/Swiss-Prot:
KCC1D_HUMAN :- The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
- Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
- Domain:
-
- The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
- Family:
-
- Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Function for CAMK1D Gene
Molecular function for CAMK1D Gene
- UniProtKB/Swiss-Prot Function:
- Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Activates the transcription factor CREB1 in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.17; Evidence={ECO:0000269|PubMed:12935886};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.17; Evidence={ECO:0000269|PubMed:12935886};.
- UniProtKB/Swiss-Prot Induction:
- Expression increases upon treatment of EC cells with DMSO and retinoic acid. Induced by KCL in PC12 cells.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Activated by Ca(2+)/calmodulin. Binding of calmodulin results in conformational change that relieves intrasteric autoinhibition and allows phosphorylation of Thr-180 within the activation loop by CaMKK1 or CaMKK2. Phosphorylation of Thr-180 results in several fold increase in total activity. Unlike CaMK4, may be unable to exhibit autonomous activity after Ca(2+)/calmodulin activation.
Enzyme Numbers (IUBMB) for CAMK1D Gene
Phenotypes From GWAS Catalog for CAMK1D Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0003824 | catalytic activity | IEA | -- |
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | IBA | 21873635 |
| GO:0004683 | calmodulin-dependent protein kinase activity | IDA | 11050006 |
Phenotypes for CAMK1D Gene
- MGI mutant phenotypes for CAMK1D:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for CAMK1D:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Decreased vaccinia virus (VACV) infection
- Increased shRNA abundance (Z-score > 2)
- Decreased NF-kappaB reporter expression
- Decreased viability
- Decreased HIV-LTR-beta-galactosidase protein expression
- Decreased IL-8 secretion
- Decreased shRNA abundance (Z-score < -2)
- Decreased Tat-dependent HIV-LTR-beta-galactosidase protein expression
- Synthetic lethal with gemcitabine
- Decreased Cdk9 T-loop phosphorylation
- toxic
Animal Model Products
-
Taconic Biosciences Mouse Models for CAMK1D
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for CAMK1D - Select products 50% OFF >
- * CAMK1D CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for CAMK1D
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CAMK1D
-
Santa Cruz Biotechnology (SCBT) CRISPR for CAMK1D
miRNA for CAMK1D Gene
- miRTarBase miRNAs that target CAMK1D
-
- mmu-miR-758-3p (MIRT007707)
- mmu-miR-425-5p (MIRT008627)
- mmu-miR-223-3p (MIRT009777)
- mmu-miR-466l-5p (MIRT584495)
- mmu-miR-297c-5p (MIRT584496)
- mmu-miR-297a-5p (MIRT584497)
- mmu-miR-297b-5p (MIRT584498)
- mmu-miR-466d-5p (MIRT584499)
- mmu-miR-466k (MIRT584500)
- mmu-miR-466i-5p (MIRT584501)
- mmu-miR-290a-5p (MIRT584502)
- mmu-miR-292a-5p (MIRT584503)
- mmu-miR-542-3p (MIRT591966)
- hsa-miR-6778-3p (MIRT618690)
- hsa-miR-6719-3p (MIRT618691)
- hsa-miR-150-5p (MIRT618692)
- hsa-miR-6814-5p (MIRT618693)
- hsa-miR-5697 (MIRT618694)
- hsa-miR-323a-3p (MIRT618695)
- hsa-miR-562 (MIRT618696)
- hsa-miR-145-5p (MIRT733960)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CAMK1D
- Browse OriGene Inhibitory RNA Products For CAMK1D
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CAMK1D
Clone Products
- Applied Biological Materials (abm): Clones for CAMK1D - Select products 50% OFF >
- * CAMK1D as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG222155
- MR222155
- MR222155L3
- MR222155L4
- MR229326
- MR229496
- MR229581
- RC207736
- RC207736L1
- RC207736L2
- RC207736L3
- RC207736L4
- RC217129
- RC217129L3
- RC217129L4
- RG207736
- RG217129
- RR202323
- RR202323L3
- RR202323L4
- MR222155L3V
- MR222155L4V
- RC207736L1V
- RC207736L2V
- RC207736L3V
- RC207736L4V
- RC217129L3V
- RC217129L4V
- RR202323L3V
- RR202323L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for CAMK1D
- Addgene plasmids for CAMK1D
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CAMK1D
Cell Line Products
-
Horizon Cell Lines for CAMK1D
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CAMK1D Gene
Localization for CAMK1D Gene
Subcellular locations from UniProtKB/Swiss-Prot for CAMK1D Gene
- Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. Nuclear localization increases upon activation by KCl treatment in hippocampal neurons.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
| plasma membrane | 2 |
| extracellular | 2 |
| mitochondrion | 2 |
| cytoskeleton | 1 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Cytosol (2)
- Nucleoplasm (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005622 | intracellular | IBA | 21873635 |
| GO:0005634 | nucleus | IEA,IDA | 16324104 |
| GO:0005737 | cytoplasm | IBA,IDA | 11050006 |
Pathways & Interactions for CAMK1D Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Neuroscience | ||
| 2 | Aldosterone synthesis and secretion | ||
| 3 | Calcium signaling pathway | ||
| 4 | Glioma |
.49
|
|
| 5 | Oxytocin signaling pathway | ||
Pathways by source for CAMK1D Gene
3 Sino Biological pathways for CAMK1D Gene
1 PharmGKB pathway for CAMK1D Gene
4 KEGG pathways for CAMK1D Gene
1 Cell Signaling Technology pathway for CAMK1D Gene
Interacting Proteins for CAMK1D Gene
GPS-Prot Interaction Network for CAMK1D
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006468 | protein phosphorylation | IEA | -- |
| GO:0006954 | inflammatory response | IEA | -- |
| GO:0007399 | nervous system development | IEA | -- |
| GO:0008152 | metabolic process | IEA | -- |
| GO:0010976 | positive regulation of neuron projection development | ISS | -- |
Drugs & Compounds for CAMK1D Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| fostamatinib | Approved, Investigational | Pharma | Target, inhibitor | Kinase Inhibitors | 0 | |
| Losartan | Approved | Pharma | Antagonist | 345 | ||
| N-(5-METHYL-1H-PYRAZOL-3-YL)-2-PHENYLQUINAZOLIN-4-AMINE | Experimental | Pharma | Target | 0 | ||
| ATP | Investigational | Nutra | Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation | 0 | ||
| Calcium | Nutra | 6556 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist | 58-64-0 |
|
Transcripts for CAMK1D Gene
mRNA/cDNA for CAMK1D Gene
- 3 REFSEQ mRNAs :
- 17 NCBI additional mRNA sequence :
- 4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000619168 8153 nts (view in UCSC)
- ENST00000487696 473 nts (view in UCSC)
- ENST00000378845 1578 nts (view in UCSC)
- ENST00000615792 1725 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for CAMK1D - Select products 50% OFF >
- * CAMK1D CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for CAMK1D
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CAMK1D
-
Santa Cruz Biotechnology (SCBT) CRISPR for CAMK1D
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CAMK1D
- Browse OriGene Inhibitory RNA Products For CAMK1D
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CAMK1D
Clone Products
- Applied Biological Materials (abm): Clones for CAMK1D - Select products 50% OFF >
- * CAMK1D as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG222155
- MR222155
- MR222155L3
- MR222155L4
- MR229326
- MR229496
- MR229581
- RC207736
- RC207736L1
- RC207736L2
- RC207736L3
- RC207736L4
- RC217129
- RC217129L3
- RC217129L4
- RG207736
- RG217129
- RR202323
- RR202323L3
- RR202323L4
- MR222155L3V
- MR222155L4V
- RC207736L1V
- RC207736L2V
- RC207736L3V
- RC207736L4V
- RC217129L3V
- RC217129L4V
- RR202323L3V
- RR202323L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for CAMK1D
- Addgene plasmids for CAMK1D
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CAMK1D
Relevant External Links for CAMK1D Gene
- GeneLoc Exon Structure for
- CAMK1D
Expression for CAMK1D Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Eye (Sensory Organs)
- Lens Vesicle Cells Lens Vesicle
- Adult Retinal Pigmented Epithelium Cells Retinal Pigmented Epithelium
- Lens
-
Blood (Hematopoietic System)
- pre Conventional Dendritic Cells Peripheral Blood
- Granulocytes Peripheral Blood
-
Liver (Hepatobiliary System)
- Perivenous Hepatocytes Liver Lobule
-
Epithelial Cells
- Adult Retinal Pigmented Epithelium Cells Retinal Pigmented Epithelium
- Bone (Muscoskeletal System)
mRNA differential expression in normal tissues according to GTEx for CAMK1D Gene
This gene is overexpressed in Brain - Frontal Cortex (BA9) (x4.8).
This gene is overexpressed in Brain (10.5), Peripheral blood mononuclear cells (10.1), Lung (8.3), and Pancreas (7.4).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for CAMK1D Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for CAMK1D
SOURCE GeneReport for Unigene cluster for CAMK1D Gene:
Hs.659517mRNA Expression by UniProt/SwissProt for CAMK1D Gene:
Q8IU85-KCC1D_HUMAN
Tissue specificity:
Widely expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes.
Evidence on tissue expression from TISSUES for CAMK1D Gene
- Pancreas(4.5)
- Liver(4.4)
- Nervous system(3.7)
- Lung(2.6)
- Blood(2.5)
- Skin(2.3)
- Muscle(2.2)
- Eye(2.1)
- Heart(2)
Primer Products
-
OriGene qPCR primer pairs for CAMK1D
-
OriGene qPCR primer pairs and template standards for CAMK1D
Gene Expression Assay Products
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for CAMK1D Gene
Orthologs for CAMK1D Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | CAMK1D 30 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | CAMK1D 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | CAMK1D 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | CAMK1D 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | CAMK1D 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Camk1d 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Camk1d 30 |
|
||
| Chicken (Gallus gallus) |
Aves | CAMK1D 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | CAMK1D 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | camk1d 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | camk1da 30 31 |
|
OneToMany | |
| camk1db 31 |
|
OneToMany | |||
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | CMK1 30 |
|
||
| Thale Cress (Arabidopsis thaliana) |
eudicotyledons | CPK20 30 |
|
||
| Rice (Oryza sativa) |
Liliopsida | Os03g0788500 30 |
|
||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
OneToMany |
- Species where no ortholog for CAMK1D was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Fruit Fly (Drosophila melanogaster)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for CAMK1D Gene
- ENSEMBL:
- Gene Tree for CAMK1D (if available)
- TreeFam:
- Gene Tree for CAMK1D (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for CAMK1D: view image
Paralogs for CAMK1D Gene
Paralogs for CAMK1D Gene
(99) SIMAP similar genes for CAMK1D Gene using alignment to 2 proteins:
- KCC1D_HUMAN
- Q5SQQ7_HUMAN
- CAMK1
- PNCK
- CAMK1G
- PSKH1
- PSKH2
- CAMK4
- DCLK1
- CAMKV
- MGC45428
- SGKL
- SGK3
- RPS6KA6
- DKFZp781N0293
- SGK2
- RPS6KA3
- MELK
- DCLK2
- DAPK3
- CHEK2
- STK33
- RPS6KA1
- PHKG1
- MYLK
- DCLK3
- PRKAA1
- CAMK2A
- BRSK1
- CAMK2G
- PRKACA
- BRSK2
- CAMK2D
- STK17A
- RPS6KB2
- PRKY
- PRKACB
- DAPK1
- AKT2
- CAMK2B
- PRKD2
- PRKX
- Par1b
- PRKCH
- PRKAA2
- NIM1K
- MYLK4
- MARK2
- MARK1
- ULK3
- SIK3
- MAPKAPK3
- SNRK
- RPS6KA2
- PRKCB
- MYLK3
- KIAA0999
- AKT3
- AURKB
- PHKG2
- RPS6KB1
- PRKD1
- PRKACG
- STK17B
- SIK1
- PRKCG
- PRKCE
- PRKCA
- MAPKAPK2
- AURKA
- AKT1
- DAPK2
- STK36
- RPS6KA4
- TSSK3
- TTN
- TRIO
- SPEG
- PKN1
- CHEK1
- OBSCN
- CASK
- AURKC
- TSSK6
- KALRN
- DKFZp586A1021
- PLK4
- PRKG2
- ULK2
- ULK1
- RPS6KA5
- PkB-like 1
- PRKG1
- PKN2
- PDPK2
- PDPK1
- MKNK2
- MKNK1
- MAPKAPK5
- MARK3
- GRK5
Variants for CAMK1D Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for CAMK1D Gene
| SNP ID | Clinical significance and condition | Chr 10 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 712064 | Benign: not provided | 12,760,972(+) | C/T | SYNONYMOUS_VARIANT | |
| 730458 | Likely Benign: not provided | 12,824,507(+) | C/T | SYNONYMOUS_VARIANT | |
| 789893 | Benign: not provided | 12,553,330(+) | A/G | MISSENSE_VARIANT,FIVE_PRIME_UTR_VARIANT | |
| rs34194224 | - | p.Ile66Met |
Residual Variation Intolerance Score:
19.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.59;
12.69% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for CAMK1D Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- CAMK1D
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CAMK1D Gene
Disorders for CAMK1D Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| ceroid lipofuscinosis, neuronal, 6 |
|
|
| maturity-onset diabetes of the young |
|
|
Search CAMK1D in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for CAMK1D
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for CAMK1D Gene
Publications for CAMK1D Gene
- Identification and characterization of CKLiK, a novel granulocyte Ca(++)/calmodulin-dependent kinase. (PMID: 11050006) Verploegen S … Coffer PJ (Blood 2000) 2 3 4 23
- Characterization of the role of CaMKI-like kinase (CKLiK) in human granulocyte function. (PMID: 15840691) Verploegen S … Coffer PJ (Blood 2005) 3 4 23
- Identification and characterization of novel components of a Ca2+/calmodulin-dependent protein kinase cascade in HeLa cells. (PMID: 12935886) Ishikawa Y … Kobayashi R (FEBS letters 2003) 3 4 23
- Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function. (PMID: 19833888) Simonis-Bik AM … 't Hart LM (Diabetes 2010) 3 41
- Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort. (PMID: 20161779) Wen J … Hu R (PloS one 2010) 3 41
ExternalLinks
Products for CAMK1D Gene
- Custom Antibody ServicesOriGene Antibodies for CAMK1D
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for CAMK1D
- Origene Custom Protein Services for CAMK1D
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CAMK1D
- Browse OriGene Inhibitory RNA Products For CAMK1D
- OriGene qPCR primer pairs for CAMK1D
- OriGene qPCR primer pairs and template standards for CAMK1D
- OriGene CRISPR knockouts for CAMK1D
- MG222155
- MR222155
- MR222155L3
- MR222155L4
- MR229326
- MR229496
- MR229581
- RC207736
- RC207736L1
- RC207736L2
- RC207736L3
- RC207736L4
- RC217129
- RC217129L3
- RC217129L4
- RG207736
- RG217129
- RR202323
- RR202323L3
- RR202323L4
- MR222155L3V
- MR222155L4V
- RC207736L1V
- RC207736L2V
- RC207736L3V
- RC207736L4V
- RC217129L3V
- RC217129L4V
- RR202323L3V
- RR202323L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CAMK1D
- Sino Biological Human cDNA Clone for CAMK1D
- Sino Biological Cell Lysates for CAMK1D
- Sino Biological Recombinant Proteins for CAMK1D
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Recombinant Proteins
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for CAMK1D
- Novus Biologicals proteins and lysates for CAMK1D
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for CAMK1D
- Abcam proteins for CAMK1D
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for CAMK1D
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for CAMK1D (AFLGC-CAMK1D)
- VectorBuilder Custom and pre-made DNA vectors for CAMK1D (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for CAMK1D (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for CAMK1D (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for CAMK1D CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for CAMK1D
- Addgene plasmids for CAMK1D
- antibodies-online: Show 41 available CAMK1D Antibodies ranked by validation data
- Compare Top CAMK1D Antibodies
- Quality Products:
- antibodies-online: Show 2 available CAMK1D Elisa Kits ranked by validation data
- Compare Top CAMK1D Elisa Kits
- Quality Products:
- antibodies-online: Show 12 available CAMK1D Proteins ranked by validation data
- Compare Top CAMK1D Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for CAMK1D
- Search Santa Cruz Biotechnology (SCBT) for CAMK1D siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for CAMK1D
- Search for CAMK1D Antibodies at ProSci
- Custom Antibody Services
- ProSci Proteins for CAMK1D
- Horizon Cell Lines for CAMK1D
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for CAMK1D
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for CAMK1D
- Search GeneCopoeia for miRNA 3'UTR Target clone products for CAMK1D
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CAMK1D
- Boster Bio Antibodies for CAMK1D
- Browse Boster Bio ELISA Kits
Sources for CAMK1D Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB