Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein k... See more...

Aliases for CAMK1 Gene

Aliases for CAMK1 Gene

  • Calcium/Calmodulin Dependent Protein Kinase I 2 3 5
  • CaMKI-Alpha 2 3 4
  • Calcium/Calmodulin-Dependent Protein Kinase Type 1 3 4
  • CaM Kinase I Alpha 3 4
  • EC 2.7.11.17 4 51
  • CaM-KI 3 4
  • CaM Kinase I 4
  • EC 2.7.11 51
  • CAMKI 3
  • CAMK1 5
  • CaMKI 2

External Ids for CAMK1 Gene

Previous GeneCards Identifiers for CAMK1 Gene

  • GC03U990094
  • GC03M009738

Summaries for CAMK1 Gene

Entrez Gene Summary for CAMK1 Gene

  • Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008]

GeneCards Summary for CAMK1 Gene

CAMK1 (Calcium/Calmodulin Dependent Protein Kinase I) is a Protein Coding gene. Among its related pathways are Association Between Physico-Chemical Features and Toxicity Associated Pathways and Immune response Function of MEF2 in T lymphocytes. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CAMK1D.

UniProtKB/Swiss-Prot Summary for CAMK1 Gene

  • Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca(2+) elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phosphorylating ARHGEF7/BETAPIX on 'Ser-694', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation (By similarity). Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K(+) and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9 and SYN1/synapsin I.

Gene Wiki entry for CAMK1 Gene

Additional gene information for CAMK1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for CAMK1 Gene

Genomics for CAMK1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for CAMK1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around CAMK1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for CAMK1

Top Transcription factor binding sites by QIAGEN in the CAMK1 gene promoter:
  • CREB
  • deltaCREB
  • Lmo2
  • NF-1
  • NF-kappaB
  • NF-kappaB1
  • POU2F1
  • POU2F1a
  • RelA

Genomic Locations for CAMK1 Gene

Genomic Locations for CAMK1 Gene
chr3:9,757,345-9,769,992
(GRCh38/hg38)
Size:
12,648 bases
Orientation:
Minus strand
chr3:9,799,026-9,811,676
(GRCh37/hg19)
Size:
12,651 bases
Orientation:
Minus strand

Genomic View for CAMK1 Gene

Genes around CAMK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CAMK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CAMK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CAMK1 Gene

Proteins for CAMK1 Gene

  • Protein details for CAMK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q14012-KCC1A_HUMAN
    Recommended name:
    Calcium/calmodulin-dependent protein kinase type 1
    Protein Accession:
    Q14012
    Secondary Accessions:
    • Q3KPF6

    Protein attributes for CAMK1 Gene

    Size:
    370 amino acids
    Molecular mass:
    41337 Da
    Quaternary structure:
    • Monomer. Interacts with XPO1 (By similarity). Interacts with MARK2, ARHGEF7/BETAPIX and GIT1.

    Three dimensional structures from OCA and Proteopedia for CAMK1 Gene

neXtProt entry for CAMK1 Gene

Selected DME Specific Peptides for CAMK1 Gene

Q14012:
  • QAFNATAVVRHMR
  • KLFEQILKAEYEFDSPYWDDISDSAKDFIR
  • STACGTPGYVAPEVLAQKPYSKAVDCWSIGVI
  • KNFAKSKW
  • GGELFDR
  • SKIMISDFGLSKME
  • ENEIAVL
  • ISDSAKD
  • YVAPEVL
  • LKPENLL
  • RDLKPEN
  • VHRDLKP
  • MQLVSGGELFDRI
  • IVHRDLK

Post-translational modifications for CAMK1 Gene

  • Phosphorylated by CaMKK1 and CaMKK2 on Thr-177.
  • Polybiquitinated by the E3 ubiquitin-protein ligase complex SCF(FBXL12), leading to proteasomal degradation.
  • Ubiquitination at Lys59
  • Modification sites at PhosphoSitePlus

Other Protein References for CAMK1 Gene

Domains & Families for CAMK1 Gene

Gene Families for CAMK1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for CAMK1 Gene

Suggested Antigen Peptide Sequences for CAMK1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA, FLJ95825, Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1),mRNA (B0YIY3_HUMAN)
  • Calcium/calmodulin-dependent protein kinase I (B5BU41_HUMAN)
  • CaM kinase I alpha (KCC1A_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q14012

UniProtKB/Swiss-Prot:

KCC1A_HUMAN :
  • The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Domain:
  • The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
genes like me logo Genes that share domains with CAMK1: view

Function for CAMK1 Gene

Molecular function for CAMK1 Gene

UniProtKB/Swiss-Prot Function:
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca(2+) elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phosphorylating ARHGEF7/BETAPIX on 'Ser-694', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation (By similarity). Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K(+) and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9 and SYN1/synapsin I.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.17;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.17;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by Ca(2+)/calmodulin. Binding of calmodulin results in conformational change that relieves intrasteric autoinhibition and allows phosphorylation of Thr-177 within the activation loop by CaMKK1 or CaMKK2. Phosphorylation of Thr-177 results in several fold increase in total activity. Unlike CaMK4, is unable to exhibit autonomous activity after Ca(2+)/calmodulin activation.

Enzyme Numbers (IUBMB) for CAMK1 Gene

Phenotypes From GWAS Catalog for CAMK1 Gene

Gene Ontology (GO) - Molecular Function for CAMK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003824 catalytic activity IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IBA 21873635
GO:0004683 calmodulin-dependent protein kinase activity IBA,ISS --
genes like me logo Genes that share ontologies with CAMK1: view
genes like me logo Genes that share phenotypes with CAMK1: view

Animal Models for CAMK1 Gene

MGI Knock Outs for CAMK1:
  • Camk1 Camk1<tm2b(EUCOMM)Hmgu>

Animal Model Products

  • Taconic Biosciences Mouse Models for CAMK1

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CAMK1

No data available for Human Phenotype Ontology , miRNA , Transcription Factor Targets and HOMER Transcription for CAMK1 Gene

Localization for CAMK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for CAMK1 Gene

Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CAMK1 gene
Compartment Confidence
cytosol 5
nucleus 4
plasma membrane 2
cytoskeleton 2
mitochondrion 2
extracellular 1
peroxisome 1
endoplasmic reticulum 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for CAMK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IBA 21873635
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0014069 postsynaptic density IEA --
genes like me logo Genes that share ontologies with CAMK1: view

Pathways & Interactions for CAMK1 Gene

PathCards logo

SuperPathways for CAMK1 Gene

SuperPathway Contained pathways
1 Activation of cAMP-Dependent PKA
.77
.77
2 NFAT and Cardiac Hypertrophy
.42
.37
3 Aldosterone synthesis and secretion
4 Calcium signaling pathway
5 Glioma
.49
genes like me logo Genes that share pathways with CAMK1: view

Pathways by source for CAMK1 Gene

2 GeneGo (Thomson Reuters) pathways for CAMK1 Gene
  • Immune response Function of MEF2 in T lymphocytes
  • Signal transduction Calcium signaling
1 R&D Systems pathway for CAMK1 Gene
8 Qiagen pathways for CAMK1 Gene
  • Activation of cAMP-Dependent PKA
  • Alpha-Adrenergic Signaling
  • Breast Cancer Regulation by Stathmin1
  • cAMP Pathway
  • IGF1R Signaling

SIGNOR curated interactions for CAMK1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for CAMK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA,IDA 11114197
GO:0006913 nucleocytoplasmic transport IEA --
GO:0007049 cell cycle IEA --
GO:0007165 signal transduction TAS,IEA --
GO:0007275 multicellular organism development IEA --
genes like me logo Genes that share ontologies with CAMK1: view

Drugs & Compounds for CAMK1 Gene

(8) Drugs for CAMK1 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
ATP Investigational Nutra Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation 0
Calcium Nutra 6556

(2) Additional Compounds for CAMK1 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist 58-64-0
genes like me logo Genes that share compounds with CAMK1: view

Transcripts for CAMK1 Gene

mRNA/cDNA for CAMK1 Gene

1 REFSEQ mRNAs :
10 NCBI additional mRNA sequence :
6 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for CAMK1

Alternative Splicing Database (ASD) splice patterns (SP) for CAMK1 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10
SP1:
SP2:
SP3: -

Relevant External Links for CAMK1 Gene

GeneLoc Exon Structure for
CAMK1

Expression for CAMK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for CAMK1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for CAMK1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (17.6), Platelet (13.1), and Bone (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for CAMK1 Gene



Protein tissue co-expression partners for CAMK1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for CAMK1

SOURCE GeneReport for Unigene cluster for CAMK1 Gene:

Hs.434875

mRNA Expression by UniProt/SwissProt for CAMK1 Gene:

Q14012-KCC1A_HUMAN
Tissue specificity: Widely expressed. Expressed in cells of the zona glomerulosa of the adrenal cortex.

Evidence on tissue expression from TISSUES for CAMK1 Gene

  • Blood(4.5)
  • Liver(4.4)
  • Nervous system(4)
  • Adrenal gland(2.6)
  • Kidney(2.2)
  • Muscle(2)
genes like me logo Genes that share expression patterns with CAMK1: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CAMK1 Gene

Orthologs for CAMK1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for CAMK1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia CAMK1 30 31
  • 99.55 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia CAMK1 30 31
  • 91.71 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia CAMK1 30 31
  • 91.71 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Camk1 30 17 31
  • 91.28 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Camk1 30
  • 91.01 (n)
Oppossum
(Monodelphis domestica)
Mammalia CAMK1 31
  • 88 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia CAMK1 31
  • 87 (a)
OneToOne
Chicken
(Gallus gallus)
Aves CAMK1 30 31
  • 80.94 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia CAMK1 31
  • 77 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia camk1 30
  • 75.84 (n)
Str.2740 30
African clawed frog
(Xenopus laevis)
Amphibia camk1-prov 30
Zebrafish
(Danio rerio)
Actinopterygii LOC794026 30
  • 77.11 (n)
BX571768.1 31
  • 76 (a)
OneToMany
CAMK1 (2 of 2) 31
  • 72 (a)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta CaMKI 32
  • 64 (a)
Worm
(Caenorhabditis elegans)
Secernentea cmk-1 32
  • 66 (a)
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AAR009W 30
  • 51.57 (n)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes CMK2 30
  • 50.11 (n)
CMK1 33
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F23155g 30
  • 46.65 (n)
Thale Cress
(Arabidopsis thaliana)
eudicotyledons CPK1 30
  • 51.59 (n)
Rice
(Oryza sativa)
Liliopsida Os12g0486600 30
  • 53.33 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 63 (a)
OneToMany
Bread mold
(Neurospora crassa)
Ascomycetes NCU09123 30
  • 52.71 (n)
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.8378 30
Species where no ortholog for CAMK1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for CAMK1 Gene

ENSEMBL:
Gene Tree for CAMK1 (if available)
TreeFam:
Gene Tree for CAMK1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for CAMK1: view image

Paralogs for CAMK1 Gene

genes like me logo Genes that share paralogs with CAMK1: view

Variants for CAMK1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for CAMK1 Gene

SNP ID Clinical significance and condition Chr 03 pos Variation AA Info Type
rs41276495 Likely Benign: Renal cell carcinoma, nonpapillary 9,765,903(-) G/A MISSENSE_VARIANT,THREE_PRIME_UTR_VARIANT,INTRON_VARIANT
rs907102077 A metastatic melanoma sample p.Pro217Ser
rs56033923 - p.Glu361Lys

Additional dbSNP identifiers (rs#s) for CAMK1 Gene

Structural Variations from Database of Genomic Variants (DGV) for CAMK1 Gene

Variant ID Type Subtype PubMed ID
nsv1010768 CNV gain 25217958
nsv821982 CNV gain 20364138

Variation tolerance for CAMK1 Gene

Residual Variation Intolerance Score: 28.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.12; 22.70% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for CAMK1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
CAMK1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CAMK1 Gene

Disorders for CAMK1 Gene

Additional Disease Information for CAMK1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform

No disorders were found for CAMK1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for CAMK1 Gene

Publications for CAMK1 Gene

  1. Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain structure and activation by phosphorylation at threonine-177 by calcium-calmodulin dependent protein kinase I kinase. (PMID: 7641687) Haribabu B … Means AR (The EMBO journal 1995) 2 3 4 23
  2. Activity-dependent synaptogenesis: regulation by a CaM-kinase kinase/CaM-kinase I/betaPIX signaling complex. (PMID: 18184567) Saneyoshi T … Soderling TR (Neuron 2008) 3 4 23
  3. Regulation of cyclin D1/Cdk4 complexes by calcium/calmodulin-dependent protein kinase I. (PMID: 14754892) Kahl CR … Means AR (The Journal of biological chemistry 2004) 3 4 23
  4. Phosphorylation screening identifies translational initiation factor 4GII as an intracellular target of Ca(2+)/calmodulin-dependent protein kinase I. (PMID: 14507913) Qin H … Edelman AM (The Journal of biological chemistry 2003) 3 4 23
  5. Calmodulin-dependent kinase I regulates adrenal cell expression of aldosterone synthase. (PMID: 12193581) Condon JC … Rainey WE (Endocrinology 2002) 3 4 23

Products for CAMK1 Gene

Sources for CAMK1 Gene