Free for academic non-profit institutions. Other users need a Commercial license
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol sign... See more...
Aliases for BPNT1 Gene
Aliases for BPNT1 Gene
External Ids for BPNT1 Gene
- HGNC: 1096
- Entrez Gene: 10380
- Ensembl: ENSG00000162813
- OMIM: 604053
- UniProtKB: O95861
Previous GeneCards Identifiers for BPNT1 Gene
- GC01M218827
- GC01M216074
- GC01M216777
- GC01M217287
- GC01M216619
- GC01M218297
- GC01M220230
- GC01M190905
Summaries for BPNT1 Gene
-
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]
GeneCards Summary for BPNT1 Gene
BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1) is a Protein Coding gene. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. Gene Ontology (GO) annotations related to this gene include magnesium ion binding and 3'(2'),5'-bisphosphate nucleotidase activity. An important paralog of this gene is IMPA2.
UniProtKB/Swiss-Prot Summary for BPNT1 Gene
-
Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.
Additional gene information for BPNT1 Gene
- HGNC(1096)
- Entrez Gene(10380)
- Ensembl(ENSG00000162813)
- OMIM(604053)
- UniProtKB(O95861)
- Open Targets Platform(ENSG00000162813)
- Monarch Initiative
- Search for BPNT1 at DataMed
- Search for BPNT1 at HumanCyc
No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for BPNT1 Gene
Genomics for BPNT1 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for BPNT1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around BPNT1 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for BPNT1
- Top Transcription factor binding sites by QIAGEN in the BPNT1 gene promoter:
-
- Arnt
- FOXD3
- FOXJ2
- FOXJ2 (long isoform)
- GATA-1
- GATA-2
- HEN1
- Ik-3
- POU2F1
- POU2F1a
Genomic Locations for BPNT1 Gene
Genomic Locations for BPNT1 Gene
- chr1:220,057,482-220,090,462
- (GRCh38/hg38)
- Size:
- 32,981 bases
- Orientation:
- Minus strand
- chr1:220,230,824-220,263,804
- (GRCh37/hg19)
- Size:
- 32,981 bases
- Orientation:
- Minus strand
Genomic View for BPNT1 Gene
Genes around BPNT1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 1q41 by HGNC
- 1q41 by Entrez Gene
- 1q41 by Ensembl
BPNT1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for BPNT1 Gene
Proteins for BPNT1 Gene
-
Protein details for BPNT1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O95861-BPNT1_HUMAN
- Recommended name:
- 3'(2'),5'-bisphosphate nucleotidase 1
- Protein Accession:
- O95861
- A8K7C8
- B4DPS5
- B4DUS9
- D3DTA9
- Q8WVL5
- Q9UGJ3
Protein attributes for BPNT1 Gene
- Size:
- 308 amino acids
- Molecular mass:
- 33392 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
- No Data Available
Protein Expression for BPNT1 Gene
Selected DME Specific Peptides for BPNT1 Gene
- O95861:
-
- EEILKQPCPSQYSAIKEEDLVVWVDP
- VLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVIL
- VWVDPLD
- AVGGKLTD
Post-translational modifications for BPNT1 Gene
Other Protein References for BPNT1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- HUABIO Anti-BPNT1 Antibody
-
Custom Antibody ServicesOriGene Antibodies for BPNT1
- Novus Biologicals Antibodies for BPNT1
-
Abcam antibodies for BPNT1
- Invitrogen Antibodies for BPNT1 (AFLGC-Bpnt1)
-
Santa Cruz Biotechnology (SCBT) Antibodies for BPNT1
Protein Products
-
OriGene Purified Proteins for BPNT1
- Search Origene for MassSpec and Protein Over-expression Lysates for BPNT1
- Origene Custom Protein Services for BPNT1
- ProSpec Recombinant Proteins for BPNT1
-
Abcam proteins for BPNT1
Domains & Families for BPNT1 Gene
Gene Families for BPNT1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for BPNT1 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for BPNT1 Gene
- GenScript: Design optimal peptide antigens:
-
- cDNA FLJ52203, highly similar to 3'(2'),5'-bisphosphate nucleotidase 1 (EC 3.1.3.7) (B4DPS5_HUMAN)
- cDNA FLJ52417, highly similar to 3'(2'),5'-bisphosphate nucleotidase 1 (EC 3.1.3.7) (B4DUS9_HUMAN)
- PAP-inositol-1,4-phosphatase (BPNT1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
O95861- Family:
-
- Belongs to the inositol monophosphatase superfamily.
Function for BPNT1 Gene
Molecular function for BPNT1 Gene
- UniProtKB/Swiss-Prot Function:
- Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=adenosine 3',5'-bisphosphate + H2O = AMP + phosphate; Xref=Rhea:RHEA:10040, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:58343, ChEBI:CHEBI:456215; EC=3.1.3.7;.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4-bisphosphate.
Enzyme Numbers (IUBMB) for BPNT1 Gene
Phenotypes From GWAS Catalog for BPNT1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0008441 | 3'(2'),5'-bisphosphate nucleotidase activity | IBA,TAS | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0046872 | metal ion binding | IEA | -- |
Phenotypes for BPNT1 Gene
- MGI mutant phenotypes for BPNT1:
- inferred from 3 alleles
- GenomeRNAi human phenotypes for BPNT1:
-
- no effect
- Increased IL-8 secretion
- Reduced mammosphere formation
- Increased Nanog expression
- Negative genetic interaction between MUS81-/- and MUS81+/+
- Negative genetic interaction between PTTG1-/- and PTTG1+/+
- Decreased viability (cell death)
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, decreased FA abundance, increased peripheral FA formation, increased cell elongation
Animal Models for BPNT1 Gene
- MGI Knock Outs for BPNT1:
-
- Bpnt1 Bpnt1<tm1Yrk>
Animal Model Products
-
Taconic Biosciences Mouse Models for BPNT1
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for BPNT1 - Select products 50% OFF >
- * BPNT1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for BPNT1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for BPNT1
-
Santa Cruz Biotechnology (SCBT) CRISPR for BPNT1
miRNA for BPNT1 Gene
- miRTarBase miRNAs that target BPNT1
-
- mmu-miR-24-3p (MIRT013743)
- mmu-miR-1935 (MIRT584571)
- mmu-miR-298-5p (MIRT584572)
- mmu-miR-709 (MIRT584573)
- mmu-miR-876-5p (MIRT584574)
- mmu-miR-1199-5p (MIRT584575)
- mmu-miR-1195 (MIRT584576)
- mmu-miR-3089-5p (MIRT584577)
- mmu-miR-665-3p (MIRT587873)
- mmu-miR-706 (MIRT587874)
- mmu-miR-10b-5p (MIRT587875)
- mmu-miR-10a-5p (MIRT587876)
- mmu-miR-339-5p (MIRT587877)
- mmu-miR-431-5p (MIRT587878)
- mmu-miR-669e-5p (MIRT587879)
- mmu-miR-694 (MIRT587880)
- mmu-miR-5135 (MIRT599587)
- mmu-miR-759 (MIRT605851)
- mmu-miR-3082-5p (MIRT605852)
- mmu-miR-804 (MIRT605853)
- mmu-miR-763 (MIRT605854)
- mmu-miR-546 (MIRT606512)
- hsa-miR-6513-5p (MIRT633715)
- hsa-miR-887-5p (MIRT633716)
- hsa-miR-3913-5p (MIRT633717)
- hsa-miR-3122 (MIRT633718)
- hsa-miR-450a-1-3p (MIRT633719)
- hsa-miR-6780a-5p (MIRT633720)
- hsa-miR-6779-5p (MIRT633721)
- hsa-miR-3689c (MIRT633722)
- hsa-miR-3689b-3p (MIRT633723)
- hsa-miR-3689a-3p (MIRT633724)
- hsa-miR-30b-3p (MIRT633725)
- hsa-miR-1273h-5p (MIRT633726)
- hsa-miR-6788-5p (MIRT633727)
- hsa-miR-30c-2-3p (MIRT633728)
- hsa-miR-30c-1-3p (MIRT633729)
- hsa-miR-7977 (MIRT633730)
- hsa-miR-1289 (MIRT633731)
- hsa-miR-1827 (MIRT633732)
- hsa-miR-383-3p (MIRT633733)
- hsa-miR-6511a-5p (MIRT633734)
- hsa-miR-1910-3p (MIRT633735)
- hsa-miR-4659b-3p (MIRT678550)
- hsa-miR-4659a-3p (MIRT678551)
- hsa-miR-6071 (MIRT678552)
- hsa-miR-6828-3p (MIRT678553)
- hsa-miR-5001-3p (MIRT678554)
- hsa-miR-4497 (MIRT678555)
- hsa-miR-4437 (MIRT678556)
- hsa-miR-5581-5p (MIRT678557)
- hsa-miR-4297 (MIRT678558)
- hsa-miR-3182 (MIRT678559)
- hsa-miR-4772-3p (MIRT678560)
- hsa-miR-1304-3p (MIRT678561)
- hsa-miR-6890-3p (MIRT678562)
- hsa-miR-335-5p (MIRT678563)
- hsa-miR-665 (MIRT694534)
- hsa-miR-6894-3p (MIRT694535)
- hsa-miR-455-3p (MIRT694536)
- hsa-miR-6771-5p (MIRT694537)
- hsa-miR-550a-5p (MIRT694538)
- hsa-miR-550a-3-5p (MIRT694539)
- hsa-miR-1271-3p (MIRT694540)
- hsa-miR-3622b-5p (MIRT694541)
- hsa-miR-7160-5p (MIRT694542)
- hsa-miR-4746-3p (MIRT694543)
- hsa-miR-4763-5p (MIRT694544)
- hsa-miR-4722-5p (MIRT694545)
- hsa-miR-6884-5p (MIRT694546)
- hsa-miR-485-5p (MIRT694547)
- hsa-miR-17-3p (MIRT694548)
- hsa-miR-4649-3p (MIRT694549)
- hsa-miR-6746-5p (MIRT694550)
- hsa-miR-1247-3p (MIRT694551)
- hsa-miR-4768-3p (MIRT694552)
- hsa-miR-5690 (MIRT694553)
- hsa-miR-5588-3p (MIRT694554)
- hsa-miR-4478 (MIRT694555)
- hsa-miR-4419b (MIRT694556)
- hsa-miR-3929 (MIRT694557)
- hsa-miR-940 (MIRT694558)
- hsa-miR-6893-5p (MIRT694559)
- hsa-miR-6808-5p (MIRT694560)
- hsa-miR-5197-5p (MIRT694561)
- hsa-miR-25-5p (MIRT764206)
- hsa-miR-4327 (MIRT768661)
- hsa-miR-4537 (MIRT770129)
- hsa-miR-6087 (MIRT775645)
- hsa-miR-6499-3p (MIRT776205)
- hsa-miR-6516-5p (MIRT777070)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for BPNT1
- Browse OriGene Inhibitory RNA Products For BPNT1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for BPNT1
Clone Products
- Applied Biological Materials (abm): Clones for BPNT1 - Select products 50% OFF >
- * BPNT1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for BPNT1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for BPNT1
Cell Line Products
-
Horizon Cell Lines for BPNT1
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for BPNT1 Gene
Localization for BPNT1 Gene
| Compartment | Confidence |
|---|---|
| cytosol | 4 |
| mitochondrion | 3 |
| nucleus | 3 |
| plasma membrane | 1 |
| extracellular | 1 |
| golgi apparatus | 1 |
- Nuclear speckles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005829 | cytosol | TAS | -- |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for BPNT1 Gene
Pathways & Interactions for BPNT1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cytochrome P450 - arranged by substrate type | ||
| 2 | Metabolism |
.40
|
|
| 3 | Sulfur metabolism | ||
Pathways by source for BPNT1 Gene
4 Reactome pathways for BPNT1 Gene
2 KEGG pathways for BPNT1 Gene
Interacting Proteins for BPNT1 Gene
GPS-Prot Interaction Network for BPNT1
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006139 | nucleobase-containing compound metabolic process | TAS | 10224133 |
| GO:0007399 | nervous system development | TAS | 10224133 |
| GO:0016311 | dephosphorylation | IEA | -- |
| GO:0046854 | phosphatidylinositol phosphorylation | IEA | -- |
| GO:0046855 | inositol phosphate dephosphorylation | IEA | -- |
No data available for SIGNOR curated interactions for BPNT1 Gene
Drugs & Compounds for BPNT1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Magnesium | Approved, Experimental, Investigational | Pharma | 0 | |||
| Phosphoric acid | Approved | Pharma | 0 | |||
| Water | Approved | Pharma | 0 | |||
| Zolpidem | Approved | Pharma | Allosteric regulator, Full agonist | 125 | ||
| Adenosine monophosphate | Approved, Investigational | Nutra | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Phosphate |
|
14066-19-4, 14265-44-2 |
|
Transcripts for BPNT1 Gene
mRNA/cDNA for BPNT1 Gene
- 4 REFSEQ mRNAs :
- 13 NCBI additional mRNA sequence :
- 11 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000469520 2737 nts (view in UCSC)
- ENST00000354807 1152 nts (view in UCSC)
- ENST00000482136 546 nts (view in UCSC)
- ENST00000463953 644 nts (view in UCSC)
- ENST00000498791 559 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for BPNT1 - Select products 50% OFF >
- * BPNT1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for BPNT1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for BPNT1
-
Santa Cruz Biotechnology (SCBT) CRISPR for BPNT1
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for BPNT1
- Browse OriGene Inhibitory RNA Products For BPNT1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for BPNT1
Clone Products
- Applied Biological Materials (abm): Clones for BPNT1 - Select products 50% OFF >
- * BPNT1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for BPNT1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for BPNT1
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9a | · | 9b | ^ | 10 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | |||||||||||||||||||||||||
| SP2: | - | ||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||
| SP4: | - | - | - |
Relevant External Links for BPNT1 Gene
- GeneLoc Exon Structure for
- BPNT1
Expression for BPNT1 Gene
This gene is overexpressed in Skin (11.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for BPNT1 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for BPNT1
SOURCE GeneReport for Unigene cluster for BPNT1 Gene:
Hs.406134mRNA Expression by UniProt/SwissProt for BPNT1 Gene:
O95861-BPNT1_HUMAN
Tissue specificity:
Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.
Evidence on tissue expression from TISSUES for BPNT1 Gene
- Liver(4.4)
- Muscle(4.2)
- Nervous system(2.6)
Primer Products
-
OriGene qPCR primer pairs for BPNT1
-
OriGene qPCR primer pairs and template standards for BPNT1
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for BPNT1 Gene
Orthologs for BPNT1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | BPNT1 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | BPNT1 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | BPNT1 30 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | BPNT1 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Bpnt1 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Bpnt1 30 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | BPNT1 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | BPNT1 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | BPNT1 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | bpnt1 30 |
|
||
| Str.3809 30 |
|
||||
| Zebrafish (Danio rerio) |
Actinopterygii | bpnt1 30 31 |
|
OneToOne | |
| Dr.15386 30 |
|
||||
| Rainbow Trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.14199 30 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP004654 30 |
|
||
| Fruit Fly (Drosophila melanogaster) |
Insecta | CG7789 30 31 32 |
|
OneToOne | |
| Worm (Caenorhabditis elegans) |
Secernentea | tag-231 30 31 |
|
OneToOne | |
| ZK430.2 32 |
|
|
|||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
OneToOne | |
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.15563 30 |
|
- Species where no ortholog for BPNT1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for BPNT1 Gene
- ENSEMBL:
- Gene Tree for BPNT1 (if available)
- TreeFam:
- Gene Tree for BPNT1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for BPNT1: view image
Paralogs for BPNT1 Gene
Variants for BPNT1 Gene
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv3588892 | CNV | loss | 21293372 |
| nsv1144433 | CNV | deletion | 24896259 |
| nsv4632 | CNV | insertion | 18451855 |
| nsv549222 | CNV | loss | 21841781 |
| nsv832636 | CNV | loss | 17160897 |
Residual Variation Intolerance Score:
44.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.64;
31.45% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for BPNT1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- BPNT1
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for BPNT1 Gene
Disorders for BPNT1 Gene
Additional Disease Information for BPNT1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No disorders were found for BPNT1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for BPNT1 Gene
Publications for BPNT1 Gene
- Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate. (PMID: 10224133) Spiegelberg BD … York JD (The Journal of biological chemistry 1999) 2 3 4 23
- Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot". (PMID: 20628624) Johnatty SE … Australian Cancer Study (Ovarian Cancer) (PLoS genetics 2010) 3 41
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
- Parkinson's disease-associated LRRK2-G2019S mutant acts through regulation of SERCA activity to control ER stress in astrocytes. (PMID: 31046837) Lee JH … Jou I (Acta neuropathologica communications 2019) 3
ExternalLinks
Products for BPNT1 Gene
- Custom Antibody ServicesOriGene Antibodies for BPNT1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for BPNT1
- Search Origene for MassSpec and Protein Over-expression Lysates for BPNT1
- Origene Custom Protein Services for BPNT1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for BPNT1
- Browse OriGene Inhibitory RNA Products For BPNT1
- OriGene qPCR primer pairs for BPNT1
- OriGene qPCR primer pairs and template standards for BPNT1
- OriGene CRISPR knockouts for BPNT1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For BPNT1
- Sino Biological Human cDNA Clone for BPNT1
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for BPNT1
- Novus Biologicals proteins and lysates for BPNT1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for BPNT1
- Abcam proteins for BPNT1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for BPNT1
- Taconic Biosciences Mouse Models for BPNT1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for BPNT1 (AFLGC-Bpnt1)
- VectorBuilder Custom and pre-made DNA vectors for BPNT1 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for BPNT1 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for BPNT1 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for BPNT1 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for BPNT1
- antibodies-online: Show 15 available BPNT1 Antibodies ranked by validation data
- Compare Top BPNT1 Antibodies
- antibodies-online: Search results for available BPNT1 related products ranked by validation data
- antibodies-online: Show 13 available BPNT1 Proteins ranked by validation data
- Compare Top BPNT1 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for BPNT1
- Search Santa Cruz Biotechnology (SCBT) for BPNT1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for BPNT1
- Horizon Cell Lines for BPNT1
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for BPNT1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for BPNT1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for BPNT1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for BPNT1
Sources for BPNT1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB