Aliases for APOBEC3G Gene
Aliases for APOBEC3G Gene
- Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G 2 3 5
- Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3G 2 3
- DNA DC->DU-Editing Enzyme APOBEC-3G 2 3
- APOBEC-Related Cytidine Deaminase 3 4
- APOBEC-Related Protein 9 3 4
- Deoxycytidine Deaminase 3 4
- CEM-15 3 4
- ARP-9 3 4
- CEM15 3 4
- ARCD 3 4
- A3G 3 4
- Apolipoprotein B Editing Enzyme Catalytic Polypeptide-Like 3G 3
- Apolipoprotein B MRNA-Editing Enzyme Catalytic Polypeptide 3G 3
External Ids for APOBEC3G Gene
- HGNC: 17357
- Entrez Gene: 60489
- Ensembl: ENSG00000239713
- OMIM: 607113
- UniProtKB: Q9HC16
Previous GeneCards Identifiers for APOBEC3G Gene
- GC22P035994
- GC22P036087
- GC22P037716
- GC22P037680
- GC22P037762
- GC22P039437
- GC22P022442
- GC22P039041
Summaries for APOBEC3G Gene
-
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-specific deamination of both RNA and single-stranded DNA. The encoded protein has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq, Mar 2017]
GeneCards Summary for APOBEC3G Gene
APOBEC3G (Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G) is a Protein Coding gene. Diseases associated with APOBEC3G include Hepatitis B and Brain Stem Infarction. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and HIV Life Cycle. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines. An important paralog of this gene is APOBEC3B.
UniProtKB/Swiss-Prot for APOBEC3G Gene
-
DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.
Additional gene information for APOBEC3G Gene
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for APOBEC3G Gene
Genomics for APOBEC3G Gene
GeneHancer (GH) Regulatory Elements for APOBEC3G Gene
Promoters and enhancers for APOBEC3G Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around APOBEC3G on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the APOBEC3G gene promoter:
Regulatory Element Products
Genomic Locations for APOBEC3G Gene
Genomic Locations for APOBEC3G Gene
- chr22:39,077,005-39,087,743
- (GRCh38/hg38)
- Size:
- 10,739 bases
- Orientation:
- Plus strand
- chr22:39,436,924-39,483,748
- (GRCh37/hg19)
Genomic View for APOBEC3G Gene
Genes around APOBEC3G on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 22q13.1 by Ensembl
- 22q13.1 by Entrez Gene
- 22q13.1 by HGNC
APOBEC3G Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for APOBEC3G Gene
Proteins for APOBEC3G Gene
-
Protein details for APOBEC3G Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9HC16-ABC3G_HUMAN
- Recommended name:
- DNA dC->dU-editing enzyme APOBEC-3G
- Protein Accession:
- Q9HC16
- B2RDR9
- Q45F02
- Q5TF77
- Q7Z2N1
- Q7Z2N4
- Q9H9H8
Protein attributes for APOBEC3G Gene
- Size:
- 384 amino acids
- Molecular mass:
- 46408 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Quaternary structure:
-
- Homodimer. Homooligomer. Can bind RNA to form ribonucleoprotein complexes of high-molecular-mass (HMM) or low-molecular-mass (LMM). HMM is inactive and heterogeneous in protein composition because of binding nonselectively to cellular RNAs, which in turn are associated with variety of cellular proteins. The LMM form which is enzymatically active has few or no RNAs associated. Its ability to form homooligomer is distinct from its ability to assemble into HMM. Interacts with APOBEC3B, APOBEC3F, MOV10, AGO2, EIF4E, EIF4ENIF1, DCP2 and DDX6 in an RNA-dependent manner. Interacts with AGO1, AGO3 and PKA/PRKACA. Interacts with HIV-1 VIF and reverse transcriptase/ribonuclease H. Interacts with hepatitis B virus capsid protein.
- Miscellaneous:
-
- Accumulation of APOBEC3G induced non-lethal hypermutation could contribute to the genetic variation of primate lentiviral populations.
- It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22.
- SequenceCaution:
-
- Sequence=CAB45274.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for APOBEC3G Gene
Protein Expression for APOBEC3G Gene
Selected DME Specific Peptides for APOBEC3G Gene
- Q9HC16:
-
- LGEILRHSMDP
- FTSWSPC
- SWSPCTKCTR
- HETYLCY
- DPKVTLTIFVARLYYFW
- SWSPCFSCA
- GRHAELC
- PFQPWDGL
- DYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRE
- HPEMRFFHWFSKWRKLHRDQE
- WVRGRHETYLCYEVER
- WLCYEVK
Post-translational modifications for APOBEC3G Gene
- Phosphorylation at Thr-32 reduces its binding to HIV-1 VIF and subsequent ubiquitination and degradation thus promoting its antiviral activity.
- Ubiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway.
- Ubiquitination at posLast=6363
Other Protein References for APOBEC3G Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for APOBEC3G (APOBEC3G)
-
Custom Antibody ServicesOriGene Antibodies for APOBEC3G
- Novus Biologicals Antibodies for APOBEC3G
-
Abcam antibodies for APOBEC3G
- Invitrogen Antibodies for APOBEC3G
- GeneTex APOBEC3G antibody for APOBEC3G
-
Custom Antibody ServicesProSci Antibodies for APOBEC3G
Protein Products
-
OriGene Purified Proteins for APOBEC3G
- Search Origene for MassSpec and Protein Over-expression Lysates for APOBEC3G
- Origene Custom Protein Services for APOBEC3G
- Search GeneTex for Proteins for APOBEC3G
-
Abcam proteins for APOBEC3G
Assay Products
- antibodies-online: Search results for 1 available APOBEC3G Elisa Kits ranked by validation data
- Compare Top APOBEC3G Elisa Kits
-
Quality Products:
Domains & Families for APOBEC3G Gene
Gene Families for APOBEC3G Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Predicted intracellular proteins
Protein Domains for APOBEC3G Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for APOBEC3G Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9HC16UniProtKB/Swiss-Prot:
ABC3G_HUMAN :- The CMP/dCMP deaminase domain 1 mediates RNA binding, RNA-dependent oligomerization and virion incorporation whereas the CMP/dCMP deaminase domain 2 confers deoxycytidine deaminase activity and substrate sequence specificity.
- Belongs to the cytidine and deoxycytidylate deaminase family.
- Domain:
-
- The CMP/dCMP deaminase domain 1 mediates RNA binding, RNA-dependent oligomerization and virion incorporation whereas the CMP/dCMP deaminase domain 2 confers deoxycytidine deaminase activity and substrate sequence specificity.
- Family:
-
- Belongs to the cytidine and deoxycytidylate deaminase family.
Function for APOBEC3G Gene
Molecular function for APOBEC3G Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- 2-deoxycytidine in single-stranded DNA + H(2)O = 2-deoxyuridine in single-stranded DNA + NH(3).
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Assembly into ribonucleoprotein complexes of high-molecular-mass (HMM) inhibits its enzymatic activity. Antiviral activity is neutralized by the HIV-1 virion infectivity factor (VIF), that prevents its incorporation into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. Can also be neutralized by simian immunodeficiency virus sooty mangabey monkey virus (SIV-sm) and chimpanzee immunodeficiency virus (SIV-cpz) VIF.
- UniProtKB/Swiss-Prot Function:
- DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.
- UniProtKB/Swiss-Prot Induction:
- Up-regulated by IFN-alpha.
Enzyme Numbers (IUBMB) for APOBEC3G Gene
Phenotypes From GWAS Catalog for APOBEC3G Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003723 | RNA binding | IDA | 11863358 |
| GO:0003824 | catalytic activity | IEA | -- |
| GO:0004126 | cytidine deaminase activity | TAS | 17121840 |
| GO:0005515 | protein binding | IPI | 14528301 |
| GO:0008270 | zinc ion binding | IDA | 11863358 |
Phenotypes for APOBEC3G Gene
- GenomeRNAi human phenotypes for APOBEC3G:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Decreased viability
- shRNA abundance <= 50%
- Decreased viability in esophageal squamous lineage
- Decreased viability ratio
- Dynamic nuclei (hole, folded or small irregular)
- Increased shRNA abundance (Z-score > 2)
- Increased cell death in breast cancer cell lines (MCF10A, MDA-MB-435)
- Decreased shRNA abundance (Z-score < -2)
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for APOBEC3G
-
-
ViGene Biosciences lentiviral particle packaged cDNA for APOBEC3G gene
-
ViGene Biosciences ready-to-package AAV shRNAs for APOBEC3G gene
- Search ViGene Biosciences for APOBEC3G
CRISPR Products
-
OriGene CRISPR knockouts for APOBEC3G
- genomics-online: gRNA clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
- Applied Biological Materials CRISPR for APOBEC3G
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for APOBEC3G
- GenScript: Design CRISPR guide RNA sequences for APOBEC3G
miRNA Products
- Search ViGene Biosciences for APOBEC3G
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for APOBEC3G
- Browse OriGene Inhibitory RNA Products For APOBEC3G
- genomics-online: shRNA clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for APOBEC3G gene
Clone Products
-
OriGene ORF clones in human for APOBEC3G
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for APOBEC3G
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for APOBEC3G
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for APOBEC3G
- Applied Biological Materials Clones for APOBEC3G
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for APOBEC3G
-
ViGene Biosciences adenoviral particle packaged cDNA for APOBEC3G gene
-
ViGene Biosciences lentiviral particle packaged cDNA for APOBEC3G gene
-
ViGene Biosciences ready-to-package AAV shRNAs for APOBEC3G gene
No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for APOBEC3G Gene
Localization for APOBEC3G Gene
Subcellular locations from UniProtKB/Swiss-Prot for APOBEC3G Gene
- Cytoplasm. Nucleus. Cytoplasm, P-body. Note=Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
- Cytosol (1)
- Nucleoplasm (1)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000932 | P-body | IDA | 16699599 |
| GO:0005634 | nucleus | IEA | -- |
| GO:0005737 | cytoplasm | IDA,IEA | 16527742 |
| GO:0005829 | cytosol | TAS | -- |
| GO:0030529 | intracellular ribonucleoprotein complex | IDA | 16699599 |
Pathways & Interactions for APOBEC3G Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | HIV Life Cycle |
.65
|
.45
|
| 2 | CDK-mediated phosphorylation and removal of Cdc6 | ||
| 3 | Dual hijack model of Vif in HIV infection | ||
| 4 | Integrated Breast Cancer Pathway | ||
Pathways by source for APOBEC3G Gene
2 BioSystems pathways for APOBEC3G Gene
6 Reactome pathways for APOBEC3G Gene
Interacting Proteins for APOBEC3G Gene
Selected Interacting proteins:
Q9HC16-ABC3G_HUMAN
ENSP00000385057
for APOBEC3G Gene via
IID
UniProtKB
STRING
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0002230 | positive regulation of defense response to virus by host | IDA | 17121840 |
| GO:0002376 | immune system process | IEA | -- |
| GO:0009972 | cytidine deamination | IDA | 16378963 |
| GO:0010529 | negative regulation of transposition | IDA | 16527742 |
| GO:0016032 | viral process | IEA | -- |
Transcripts for APOBEC3G Gene
mRNA/cDNA for APOBEC3G Gene
- (7) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (139) Selected AceView cDNA sequences:
- (7) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for APOBEC3G Gene
CRISPR Products
-
OriGene CRISPR knockouts for APOBEC3G
- genomics-online: gRNA clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
- Applied Biological Materials CRISPR for APOBEC3G
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for APOBEC3G
- GenScript: Design CRISPR guide RNA sequences for APOBEC3G
miRNA Products
- Search ViGene Biosciences for APOBEC3G
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for APOBEC3G
- Browse OriGene Inhibitory RNA Products For APOBEC3G
- genomics-online: shRNA clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for APOBEC3G gene
Clone Products
-
OriGene ORF clones in human for APOBEC3G
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for APOBEC3G
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for APOBEC3G
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for APOBEC3G
- Applied Biological Materials Clones for APOBEC3G
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Expression for APOBEC3G Gene
mRNA differential expression in normal tissues according to GTEx for APOBEC3G Gene
This gene is overexpressed in Whole Blood (x8.7).
This gene is overexpressed in Bone marrow stromal cell (28.6), Peripheral blood mononuclear cells (17.2), and NK cells (10.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for APOBEC3G Gene
NURSA nuclear receptor signaling pathways regulating expression of APOBEC3G Gene:
APOBEC3GSOURCE GeneReport for Unigene cluster for APOBEC3G Gene:
Hs.660143mRNA Expression by UniProt/SwissProt for APOBEC3G Gene:
Q9HC16-ABC3G_HUMAN
Tissue specificity:
Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines. Exists only in the LMM form in peripheral blood-derived resting CD4 T-cells and monocytes, both of which are refractory to HIV-1 infection. LMM is converted to a HMM complex when resting CD4 T-cells are activated or when monocytes are induced to differentiate into macrophages. This change correlates with increased susceptibility of these cells to HIV-1 infection.
Evidence on tissue expression from TISSUES for APOBEC3G Gene
- Kidney(4.3)
- Skin(4)
- Blood(2.7)
- Lymph node(2.5)
- Spleen(2.4)
Primer Products
-
OriGene qPCR primer pairs for APOBEC3G
-
OriGene qPCR primer pairs and template standards for APOBEC3G
- genomics-online: primer clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for APOBEC3G Gene
Orthologs for APOBEC3G Gene
This gene was present in the common ancestor of mammals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | APOBEC3G 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | APOBEC3A 34 |
|
OneToMany | |
| dog (Canis familiaris) |
Mammalia | -- 34 |
|
ManyToMany | |
| -- 34 |
|
ManyToMany |
- Species where no ortholog for APOBEC3G was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- lizard (Anolis carolinensis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- mouse (Mus musculus)
- oppossum (Monodelphis domestica)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- platypus (Ornithorhynchus anatinus)
- rainbow trout (Oncorhynchus mykiss)
- rat (Rattus norvegicus)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- tropical clawed frog (Silurana tropicalis)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
- zebrafish (Danio rerio)
Paralogs for APOBEC3G Gene
Paralogs for APOBEC3G Gene
(11) SIMAP similar genes for APOBEC3G Gene using alignment to 4 proteins:
Pseudogenes.org Pseudogenes for APOBEC3G Gene
Variants for APOBEC3G Gene
| SNP ID | Clin | Chr 22 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000243581 | -- | 39,076,889(+) | G/A | upstream_transcript_variant | |
| rs1000300520 | -- | 39,087,386(+) | T/G | coding_sequence_variant, intron_variant, missense_variant | |
| rs1001118858 | -- | 39,083,496(+) | T/C | intron_variant | |
| rs1001583704 | -- | 39,082,565(+) | G/A | intron_variant | |
| rs1001807433 | -- | 39,087,683(+) | G/T | 3_prime_UTR_variant |
Residual Variation Intolerance Score:
44.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.70;
57.30% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for APOBEC3G Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for APOBEC3G Gene
Disorders for APOBEC3G Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| hepatitis b |
|
|
| brain stem infarction |
|
|
| immunodeficiency with hyper-igm, type 2 |
|
|
| human immunodeficiency virus infectious disease |
|
|
| basilar artery occlusion |
|
|
Search APOBEC3G in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for APOBEC3G
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for APOBEC3G Gene
Publications for APOBEC3G Gene
- APOBEC3G expression is dysregulated in primary HIV-1 infection and polymorphic variants influence CD4+ T-cell counts and plasma viral load. (PMID: 19996938) Reddy K … CAPRISA Acute Infection Study Team (AIDS (London, England) 2010) 3 22 44 58
- Structure, interaction and real-time monitoring of the enzymatic reaction of wild-type APOBEC3G. (PMID: 19153609) Furukawa A … Katahira M (The EMBO journal 2009) 3 4 22 58
- Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. (PMID: 18288108) Chen KM … Matsuo H (Nature 2008) 3 4 22 58
- [The associations between polymorphisms of APOBEC3G and different outcomes of persistent HBV infection]. (PMID: 18647522) Tian D … Cui JJ (Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2008) 3 22 44 58
- Absence of H186R polymorphism in exon 4 of the APOBEC3G gene among North Indian individuals. (PMID: 18652534) Rathore A … Dhole TN (Genetic testing 2008) 3 22 44 58
Products for APOBEC3G Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for APOBEC3G
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for APOBEC3G
- Search Origene for MassSpec and Protein Over-expression Lysates for APOBEC3G
- Origene Custom Protein Services for APOBEC3G
- Origene shrna, sirna, and RNAi products in human, mouse, rat for APOBEC3G
- Browse OriGene Inhibitory RNA Products For APOBEC3G
- OriGene qPCR primer pairs and template standards for APOBEC3G
- OriGene qPCR primer pairs for APOBEC3G
- OriGene CRISPR knockouts for APOBEC3G
- OriGene ORF clones in human for APOBEC3G
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For APOBEC3G
- GenScript: Next-day shipping of latest version cDNA ORF clones for APOBEC3G in any vector
- GenScript Custom Purified and Recombinant Proteins Services for APOBEC3G
- GenScript Custom Assay Services for APOBEC3G
- GenScript Custom overexpressing Cell Line Services for APOBEC3G
- GenScript: Design CRISPR guide RNA sequences for APOBEC3G
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for APOBEC3G
- Cell Signaling Technology (CST) Antibodies for APOBEC3G (APOBEC3G)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for APOBEC3G
- Novus Biologicals lysates and proteins for APOBEC3G
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for APOBEC3G
- Abcam proteins for APOBEC3G
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for APOBEC3G
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for APOBEC3G
- VectorBuilder custom plasmid, inducible vectors for APOBEC3G
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for APOBEC3G
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for APOBEC3G
- antibodies-online: Search results for 174 available APOBEC3G Antibodies ranked by validation data
- Compare Top APOBEC3G Antibodies
- Quality Products:
- antibodies-online: Search results for 1 available APOBEC3G Elisa Kits ranked by validation data
- Compare Top APOBEC3G Elisa Kits
- Quality Products:
- antibodies-online: Search results for 9 available APOBEC3G Proteins ranked by validation data
- Compare Top APOBEC3G Proteins
- Quality Products:
- GeneTex APOBEC3G antibody for APOBEC3G
- Search GeneTex for Proteins for APOBEC3G
- ViGene Biosciences adenoviral particle packaged cDNA for APOBEC3G gene
- ViGene Biosciences lentiviral particle packaged cDNA for APOBEC3G gene
- ViGene Biosciences ready-to-package AAV shRNAs for APOBEC3G gene
- Search ViGene Biosciences for APOBEC3G
- Horizon Cell Lines for APOBEC3G
- genomics-online: cdna clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
- orf clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
- genomics-online: gRNA clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
- genomics-online: primer clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
- genomics-online: shRNA clones - Search results for 45 available APOBEC3G gene related products
- Overview of 45 available APOBEC3G gene related products
Sources for APOBEC3G Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew