Free for academic non-profit institutions. Other users need a Commercial license
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-spec... See more...
Aliases for APOBEC3G Gene
Aliases for APOBEC3G Gene
- Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G 2 3 5
- DNA DC->DU-Editing Enzyme APOBEC-3G 2 3 4
- CEM15 2 3 4
- Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3G 2 3
- APOBEC-Related Cytidine Deaminase 3 4
- APOBEC-Related Protein 9 3 4
- Deoxycytidine Deaminase 3 4
- DJ494G10.1 2 3
- BK150C2.7 2 3
- CEM-15 3 4
- MDS019 2 3
- ARP-9 3 4
- ARCD 3 4
- A3G 3 4
- Apolipoprotein B Editing Enzyme Catalytic Polypeptide-Like 3G 3
- Apolipoprotein B MRNA-Editing Enzyme Catalytic Polypeptide 3G 3
- Apolipoprotein B MRNA Editing Enzyme Cytidine Deaminase 3
- Phorbolin-Like Protein MDS019 3
- DNA DC->DU Editing Enzyme 3
- APOBEC-Related Protein 4
- EC 3.5.4.5 51
- EC 3.5.4.- 4
- APOBEC3G 5
- FLJ12740 2
- EC 3.5.4 51
- ARP9 3
External Ids for APOBEC3G Gene
- HGNC: 17357
- Entrez Gene: 60489
- Ensembl: ENSG00000239713
- OMIM: 607113
- UniProtKB: Q9HC16
Previous GeneCards Identifiers for APOBEC3G Gene
- GC22P035994
- GC22P036087
- GC22P037716
- GC22P037680
- GC22P037762
- GC22P039437
- GC22P022442
- GC22P039041
Summaries for APOBEC3G Gene
-
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-specific deamination of both RNA and single-stranded DNA. The encoded protein has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq, Mar 2017]
GeneCards Summary for APOBEC3G Gene
APOBEC3G (Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G) is a Protein Coding gene. Diseases associated with APOBEC3G include Hepatitis B and Hepatitis. Among its related pathways are HIV Life Cycle and Dual hijack model of Vif in HIV infection. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines. An important paralog of this gene is APOBEC3B.
UniProtKB/Swiss-Prot Summary for APOBEC3G Gene
-
DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.
Additional gene information for APOBEC3G Gene
- HGNC(17357)
- Entrez Gene(60489)
- Ensembl(ENSG00000239713)
- OMIM(607113)
- UniProtKB(Q9HC16)
- Open Targets Platform(ENSG00000239713)
- Search for APOBEC3G at DataMed
- Search for APOBEC3G at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for APOBEC3G Gene
Genomics for APOBEC3G Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for APOBEC3G Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around APOBEC3G on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for APOBEC3G
- Top Transcription factor binding sites by QIAGEN in the APOBEC3G gene promoter:
-
- c-Myc
- C/EBPalpha
- GR
- GR-alpha
- Max
- SREBP-1c
- XBP-1
- ZID
Genomic Locations for APOBEC3G Gene
Genomic Locations for APOBEC3G Gene
- chr22:39,077,005-39,087,743
- (GRCh38/hg38)
- Size:
- 10,739 bases
- Orientation:
- Plus strand
- chr22:39,436,924-39,483,748
- (GRCh37/hg19)
- Size:
- 46,825 bases
- Orientation:
- Plus strand
Genomic View for APOBEC3G Gene
Genes around APOBEC3G on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 22q13.1 by HGNC
- 22q13.1 by Entrez Gene
- 22q13.1 by Ensembl
APOBEC3G Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for APOBEC3G Gene
Proteins for APOBEC3G Gene
-
Protein details for APOBEC3G Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9HC16-ABC3G_HUMAN
- Recommended name:
- DNA dC->dU-editing enzyme APOBEC-3G
- Protein Accession:
- Q9HC16
- B2RDR9
- Q45F02
- Q5TF77
- Q7Z2N1
- Q7Z2N4
- Q9H9H8
Protein attributes for APOBEC3G Gene
- Size:
- 384 amino acids
- Molecular mass:
- 46408 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Quaternary structure:
-
- Homodimer. Homooligomer. Can bind RNA to form ribonucleoprotein complexes of high-molecular-mass (HMM) or low-molecular-mass (LMM). HMM is inactive and heterogeneous in protein composition because of binding nonselectively to cellular RNAs, which in turn are associated with variety of cellular proteins. The LMM form which is enzymatically active has few or no RNAs associated. Its ability to form homooligomer is distinct from its ability to assemble into HMM. Interacts with APOBEC3B, APOBEC3F, MOV10, AGO2, EIF4E, EIF4ENIF1, DCP2 and DDX6 in an RNA-dependent manner. Interacts with AGO1, AGO3 and PKA/PRKACA.
- (Microbial infection) Interacts with HIV-1 Vif and reverse transcriptase/ribonuclease H.
- (Microbial infection) Interacts with hepatitis B virus capsid protein.
- Miscellaneous:
-
- Accumulation of APOBEC3G induced non-lethal hypermutation could contribute to the genetic variation of primate lentiviral populations.
- It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22.
- [Isoform 3]: May be due to a competing donor splice site.
Three dimensional structures from OCA and Proteopedia for APOBEC3G Gene
Protein Expression for APOBEC3G Gene
Selected DME Specific Peptides for APOBEC3G Gene
- Q9HC16:
-
- LGEILRHSMDP
- FTSWSPC
- SWSPCTKCTR
- HETYLCY
- DPKVTLTIFVARLYYFW
- SWSPCFSCA
- GRHAELC
- PFQPWDGL
- DYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRE
- HPEMRFFHWFSKWRKLHRDQE
- WVRGRHETYLCYEVER
- WLCYEVK
Post-translational modifications for APOBEC3G Gene
- Ubiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway.
- Phosphorylation at Thr-32 reduces its binding to HIV-1 VIF and subsequent ubiquitination and degradation thus promoting its antiviral activity.
-
Ubiquitination at Lys63
- NX_Q9HC16 (NX_Q9HC16-1)
- Modification sites at PhosphoSitePlus
Other Protein References for APOBEC3G Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ APOBEC3G Antibody
- NSJ Bioreagents APOBEC3G Antibody
- HUABIO Anti-APOBEC3G Antibody
-
Custom Antibody ServicesOriGene Antibodies for APOBEC3G
- Novus Biologicals Antibodies for APOBEC3G
- Invitrogen Antibodies for APOBEC3G (AFLGC-APOBEC3G)
-
Custom Antibody ServicesProSci Antibodies for APOBEC3G
Protein Products
-
OriGene Purified Proteins for APOBEC3G
- Search Origene for MassSpec and Protein Over-expression Lysates for APOBEC3G
- Origene Custom Protein Services for APOBEC3G
- antibodies-online: Show 9 available APOBEC3G Proteins ranked by validation data
- Compare Top APOBEC3G Proteins
-
Quality Products:
-
Signalway Proteins for APOBEC3G
-
Abcam proteins for APOBEC3G
Domains & Families for APOBEC3G Gene
Gene Families for APOBEC3G Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Predicted intracellular proteins
Protein Domains for APOBEC3G Gene
- InterPro:
- Blocks:
-
- APOBEC-like, C-terminal
- ProtoNet:
Suggested Antigen Peptide Sequences for APOBEC3G Gene
- GenScript: Design optimal peptide antigens:
-
- CEM-15 (ABC3G_HUMAN)
- Apolipoprotein B mRNA editing enzyme (B2LYL6_HUMAN)
- Apolipoprotein B mRNA editing enzyme cytidine deaminase (F2YHL6_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9HC16UniProtKB/Swiss-Prot:
ABC3G_HUMAN :- The CMP/dCMP deaminase domain 1 mediates RNA binding, RNA-dependent oligomerization and virion incorporation whereas the CMP/dCMP deaminase domain 2 confers deoxycytidine deaminase activity and substrate sequence specificity.
- Belongs to the cytidine and deoxycytidylate deaminase family.
- Domain:
-
- The CMP/dCMP deaminase domain 1 mediates RNA binding, RNA-dependent oligomerization and virion incorporation whereas the CMP/dCMP deaminase domain 2 confers deoxycytidine deaminase activity and substrate sequence specificity.
- Family:
-
- Belongs to the cytidine and deoxycytidylate deaminase family.
Function for APOBEC3G Gene
Molecular function for APOBEC3G Gene
- UniProtKB/Swiss-Prot Function:
- DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=a 2'-deoxycytidine in a single-stranded DNA + H(+) + H2O = a 2'-deoxyuridine in a single-stranded DNA + NH4(+); Xref=Rhea:RHEA:50948, Rhea:RHEA-COMP:12846, Rhea:RHEA-COMP:12847, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:28938, ChEBI:CHEBI:85452, ChEBI:CHEBI:133902; Evidence={ECO:0000269|PubMed:12808465, ECO:0000269|PubMed:18288108, ECO:0000269|PubMed:18849968, ECO:0000269|PubMed:19153609};.
- UniProtKB/Swiss-Prot Induction:
- Up-regulated by IFN-alpha.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Assembly into ribonucleoprotein complexes of high-molecular-mass (HMM) inhibits its enzymatic activity. Antiviral activity is neutralized by the HIV-1 virion infectivity factor (VIF), that prevents its incorporation into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. Can also be neutralized by simian immunodeficiency virus sooty mangabey monkey virus (SIV-sm) and chimpanzee immunodeficiency virus (SIV-cpz) VIF.
Enzyme Numbers (IUBMB) for APOBEC3G Gene
Phenotypes From GWAS Catalog for APOBEC3G Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003723 | RNA binding | IBA,IDA | 11863358 |
| GO:0003824 | catalytic activity | IEA | -- |
| GO:0004126 | cytidine deaminase activity | TAS | 17121840 |
| GO:0005515 | protein binding | IPI | 14528301 |
| GO:0008270 | zinc ion binding | IDA | 11863358 |
Phenotypes for APOBEC3G Gene
- GenomeRNAi human phenotypes for APOBEC3G:
-
- no effect
- Decreased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Decreased viability ratio
- shRNA abundance <= 25%
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Increased viability
- Decreased shRNA abundance (Z-score < -2)
- Decreased viability in esophageal squamous lineage
- Increased cell death in breast cancer cell lines (MCF10A, MDA-MB-435)
- Increased nuclear migration speed
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for APOBEC3G - Select products 50% OFF >
- * APOBEC3G CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for APOBEC3G
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for APOBEC3G
-
Santa Cruz Biotechnology (SCBT) CRISPR for APOBEC3G
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for APOBEC3G
- Browse OriGene Inhibitory RNA Products For APOBEC3G
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for APOBEC3G
Clone Products
- Applied Biological Materials (abm): Clones for APOBEC3G - Select products 50% OFF >
- * APOBEC3G as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for APOBEC3G
- Addgene plasmids for APOBEC3G
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for APOBEC3G
Cell Line Products
-
Horizon Cell Lines for APOBEC3G
No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for APOBEC3G Gene
Localization for APOBEC3G Gene
Subcellular locations from UniProtKB/Swiss-Prot for APOBEC3G Gene
- Cytoplasm. Nucleus. Cytoplasm, P-body. Note=Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
| plasma membrane | 2 |
| extracellular | 2 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| lysosome | 2 |
| golgi apparatus | 1 |
- Cytosol (1)
- Nucleoplasm (1)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000932 | P-body | IEA,IDA | 16699599 |
| GO:0005634 | nucleus | IBA | 21873635 |
| GO:0005737 | cytoplasm | IBA,IDA | 16527742 |
| GO:0005829 | cytosol | TAS | -- |
| GO:0030895 | apolipoprotein B mRNA editing enzyme complex | TAS | 17121840 |
Pathways & Interactions for APOBEC3G Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | HIV Life Cycle |
.65
|
.45
|
| 2 | Human cytomegalovirus infection | ||
| 3 | Regulation of activated PAK-2p34 by proteasome mediated degradation | ||
| 4 | Dual hijack model of Vif in HIV infection | ||
| 5 | Integrated Breast Cancer Pathway | ||
Pathways by source for APOBEC3G Gene
2 BioSystems pathways for APOBEC3G Gene
6 Reactome pathways for APOBEC3G Gene
1 KEGG pathway for APOBEC3G Gene
Interacting Proteins for APOBEC3G Gene
Selected Interacting proteins:
Q9HC16-ABC3G_HUMAN
ENSP00000385057
for APOBEC3G Gene via
UniProtKB
STRING
IID
GPS-Prot Interaction Network for APOBEC3G
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0002230 | positive regulation of defense response to virus by host | IDA | 17121840 |
| GO:0002376 | immune system process | IEA | -- |
| GO:0009972 | cytidine deamination | IDA | 16378963 |
| GO:0010529 | negative regulation of transposition | IDA | 16527742 |
| GO:0016032 | viral process | IEA | -- |
Transcripts for APOBEC3G Gene
mRNA/cDNA for APOBEC3G Gene
- 4 REFSEQ mRNAs :
- 15 NCBI additional mRNA sequence :
- 7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000407997 1564 nts (view in UCSC)
- ENST00000463934 1081 nts (view in UCSC)
- ENST00000480000 812 nts (view in UCSC)
- ENST00000461827 803 nts (view in UCSC)
- ENST00000486357 543 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for APOBEC3G - Select products 50% OFF >
- * APOBEC3G CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for APOBEC3G
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for APOBEC3G
-
Santa Cruz Biotechnology (SCBT) CRISPR for APOBEC3G
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for APOBEC3G
- Browse OriGene Inhibitory RNA Products For APOBEC3G
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for APOBEC3G
Clone Products
- Applied Biological Materials (abm): Clones for APOBEC3G - Select products 50% OFF >
- * APOBEC3G as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for APOBEC3G
- Addgene plasmids for APOBEC3G
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for APOBEC3G
Relevant External Links for APOBEC3G Gene
- GeneLoc Exon Structure for
- APOBEC3G
Expression for APOBEC3G Gene
mRNA differential expression in normal tissues according to GTEx for APOBEC3G Gene
This gene is overexpressed in Whole Blood (x8.7).
This gene is overexpressed in Bone marrow stromal cell (28.6), Peripheral blood mononuclear cells (17.2), and NK cells (10.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for APOBEC3G Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for APOBEC3G
SOURCE GeneReport for Unigene cluster for APOBEC3G Gene:
Hs.660143mRNA Expression by UniProt/SwissProt for APOBEC3G Gene:
Q9HC16-ABC3G_HUMAN
Tissue specificity:
Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines. Exists only in the LMM form in peripheral blood-derived resting CD4 T-cells and monocytes, both of which are refractory to HIV-1 infection. LMM is converted to a HMM complex when resting CD4 T-cells are activated or when monocytes are induced to differentiate into macrophages. This change correlates with increased susceptibility of these cells to HIV-1 infection.
Evidence on tissue expression from TISSUES for APOBEC3G Gene
- Kidney(4.5)
- Skin(4.4)
- Blood(3.1)
- Lymph node(3.1)
- Spleen(3)
- Intestine(2.6)
- Liver(2.3)
- Bone marrow(2.2)
- Lung(2.1)
Primer Products
-
OriGene qPCR primer pairs for APOBEC3G
-
OriGene qPCR primer pairs and template standards for APOBEC3G
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for APOBEC3G Gene
Orthologs for APOBEC3G Gene
This gene was present in the common ancestor of mammals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | APOBEC3G 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | APOBEC3A 31 |
|
OneToMany | |
| Dog (Canis familiaris) |
Mammalia | -- 31 |
|
ManyToMany | |
| -- 31 |
|
ManyToMany |
- Species where no ortholog for APOBEC3G was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Fruit Fly (Drosophila melanogaster)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Lizard (Anolis carolinensis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Mouse (Mus musculus)
- Oppossum (Monodelphis domestica)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Platypus (Ornithorhynchus anatinus)
- Rainbow Trout (Oncorhynchus mykiss)
- Rat (Rattus norvegicus)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Squirt (Ciona savignyi)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Tropical Clawed Frog (Silurana tropicalis)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
- Zebrafish (Danio rerio)
Evolution for APOBEC3G Gene
- ENSEMBL:
- Gene Tree for APOBEC3G (if available)
- TreeFam:
- Gene Tree for APOBEC3G (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for APOBEC3G: view image
Paralogs for APOBEC3G Gene
Paralogs for APOBEC3G Gene
(11) SIMAP similar genes for APOBEC3G Gene using alignment to 4 proteins:
- ABC3G_HUMAN
- B2LYL6_HUMAN
- F2YHL6_HUMAN
- M4VSD8_HUMAN
Pseudogenes.org Pseudogenes for APOBEC3G Gene
Variants for APOBEC3G Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for APOBEC3G Gene
| SNP ID | Clinical significance and condition | Chr 22 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs17000736 | - | p.Arg256His | |||
| rs17496046 | - | p.Gln275Glu | |||
| rs8177832 | - | p.His186Arg |
Residual Variation Intolerance Score:
44.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.70;
57.30% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for APOBEC3G Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for APOBEC3G Gene
Disorders for APOBEC3G Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| hepatitis b |
|
|
| hepatitis |
|
|
| human immunodeficiency virus infectious disease |
|
|
| immune deficiency disease |
|
|
| human immunodeficiency virus type 1 |
|
Search APOBEC3G in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for APOBEC3G
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for APOBEC3G Gene
Publications for APOBEC3G Gene
- APOBEC3G expression is dysregulated in primary HIV-1 infection and polymorphic variants influence CD4+ T-cell counts and plasma viral load. (PMID: 19996938) Reddy K … CAPRISA Acute Infection Study Team (AIDS (London, England) 2010) 3 23 41
- Structure, interaction and real-time monitoring of the enzymatic reaction of wild-type APOBEC3G. (PMID: 19153609) Furukawa A … Katahira M (The EMBO journal 2009) 3 4 23
- Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. (PMID: 18288108) Chen KM … Matsuo H (Nature 2008) 3 4 23
- Phosphorylation of APOBEC3G by protein kinase A regulates its interaction with HIV-1 Vif. (PMID: 18836454) Shirakawa K … Uchiyama T (Nature structural & molecular biology 2008) 3 4 23
- Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. (PMID: 18849968) Holden LG … Chen XS (Nature 2008) 3 4 23
ExternalLinks
Products for APOBEC3G Gene
- Custom Antibody ServicesOriGene Antibodies for APOBEC3G
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for APOBEC3G
- Search Origene for MassSpec and Protein Over-expression Lysates for APOBEC3G
- Origene Custom Protein Services for APOBEC3G
- Origene shrna, sirna, and RNAi products in human, mouse, rat for APOBEC3G
- Browse OriGene Inhibitory RNA Products For APOBEC3G
- OriGene qPCR primer pairs for APOBEC3G
- OriGene qPCR primer pairs and template standards for APOBEC3G
- OriGene CRISPR knockouts for APOBEC3G
- OriGene ORF clones in human for APOBEC3G
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For APOBEC3G
- Sino Biological Human cDNA Clone for APOBEC3G
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for APOBEC3G
- Novus Biologicals proteins and lysates for APOBEC3G
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam proteins for APOBEC3G
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for APOBEC3G (AFLGC-APOBEC3G)
- VectorBuilder Custom and pre-made DNA vectors for APOBEC3G (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for APOBEC3G (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for APOBEC3G (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for APOBEC3G CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for APOBEC3G
- Addgene plasmids for APOBEC3G
- antibodies-online: Show 52 available APOBEC3G Antibodies ranked by validation data
- Compare Top APOBEC3G Antibodies
- antibodies-online: Search results for available APOBEC3G related products ranked by validation data
- antibodies-online: Show 9 available APOBEC3G Proteins ranked by validation data
- Compare Top APOBEC3G Proteins
- Quality Products:
- Horizon Cell Lines for APOBEC3G
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for APOBEC3G
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for APOBEC3G
- Search GeneCopoeia for miRNA 3'UTR Target clone products for APOBEC3G
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for APOBEC3G
- Signalway Proteins for APOBEC3G
Sources for APOBEC3G Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB