APOBEC3G Gene (Protein Coding)

Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G

GC22P039078
GIFtS:
43
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-spec... See more...

Aliases for APOBEC3G Gene

Aliases for APOBEC3G Gene

  • Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G 2 3 5
  • DNA DC->DU-Editing Enzyme APOBEC-3G 2 3 4
  • Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3G 2 3
  • APOBEC-Related Cytidine Deaminase 3 4
  • APOBEC-Related Protein 9 3 4
  • Deoxycytidine Deaminase 3 4
  • CEM-15 3 4
  • ARP-9 3 4
  • CEM15 3 4
  • ARCD 3 4
  • A3G 3 4
  • Apolipoprotein B Editing Enzyme Catalytic Polypeptide-Like 3G 3
  • Apolipoprotein B MRNA-Editing Enzyme Catalytic Polypeptide 3G 3
  • Apolipoprotein B MRNA Editing Enzyme Cytidine Deaminase 3
  • Phorbolin-Like Protein MDS019 3
  • DNA DC->DU Editing Enzyme 3
  • APOBEC-Related Protein 4
  • DJ494G10.1 3
  • EC 3.5.4.5 54
  • EC 3.5.4.- 4
  • BK150C2.7 3
  • EC 3.5.4 54
  • MDS019 3
  • ARP9 3

External Ids for APOBEC3G Gene

Previous GeneCards Identifiers for APOBEC3G Gene

  • GC22P035994
  • GC22P036087
  • GC22P037716
  • GC22P037680
  • GC22P037762
  • GC22P039437
  • GC22P022442
  • GC22P039041

Summaries for APOBEC3G Gene

Entrez Gene Summary for APOBEC3G Gene

  • This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-specific deamination of both RNA and single-stranded DNA. The encoded protein has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq, Mar 2017]

GeneCards Summary for APOBEC3G Gene

APOBEC3G (Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 3G) is a Protein Coding gene. Diseases associated with APOBEC3G include Hepatitis B and Brain Stem Infarction. Among its related pathways are Dual hijack model of Vif in HIV infection and HIV Life Cycle. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines. An important paralog of this gene is APOBEC3B.

UniProtKB/Swiss-Prot Summary for APOBEC3G Gene

  • DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.

Gene Wiki entry for APOBEC3G Gene

Additional gene information for APOBEC3G Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for APOBEC3G Gene

Genomics for APOBEC3G Gene

GeneHancer (GH) Regulatory Elements for APOBEC3G Gene

Promoters and enhancers for APOBEC3G Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around APOBEC3G on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the APOBEC3G gene promoter:
  • c-Myc
  • C/EBPalpha
  • GR
  • GR-alpha
  • Max
  • SREBP-1c
  • XBP-1
  • ZID

Genomic Locations for APOBEC3G Gene

Genomic Locations for APOBEC3G Gene
chr22:39,077,005-39,087,743
(GRCh38/hg38)
Size:
10,739 bases
Orientation:
Plus strand
chr22:39,436,924-39,483,748
(GRCh37/hg19)
Size:
46,825 bases
Orientation:
Plus strand

Genomic View for APOBEC3G Gene

Genes around APOBEC3G on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
APOBEC3G Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for APOBEC3G Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for APOBEC3G Gene

Proteins for APOBEC3G Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for APOBEC3G Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9HC16-ABC3G_HUMAN
    Recommended name:
    DNA dC->dU-editing enzyme APOBEC-3G
    Protein Accession:
    Q9HC16
    Secondary Accessions:
    • B2RDR9
    • Q45F02
    • Q5TF77
    • Q7Z2N1
    • Q7Z2N4
    • Q9H9H8

    Protein attributes for APOBEC3G Gene

    Size:
    384 amino acids
    Molecular mass:
    46408 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Homodimer. Homooligomer. Can bind RNA to form ribonucleoprotein complexes of high-molecular-mass (HMM) or low-molecular-mass (LMM). HMM is inactive and heterogeneous in protein composition because of binding nonselectively to cellular RNAs, which in turn are associated with variety of cellular proteins. The LMM form which is enzymatically active has few or no RNAs associated. Its ability to form homooligomer is distinct from its ability to assemble into HMM. Interacts with APOBEC3B, APOBEC3F, MOV10, AGO2, EIF4E, EIF4ENIF1, DCP2 and DDX6 in an RNA-dependent manner. Interacts with AGO1, AGO3 and PKA/PRKACA.
    • (Microbial infection) Interacts with HIV-1 Vif and reverse transcriptase/ribonuclease H.
    • (Microbial infection) Interacts with hepatitis B virus capsid protein.
    Miscellaneous:
    • Accumulation of APOBEC3G induced non-lethal hypermutation could contribute to the genetic variation of primate lentiviral populations.
    • It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22.

    Three dimensional structures from OCA and Proteopedia for APOBEC3G Gene

    Alternative splice isoforms for APOBEC3G Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for APOBEC3G Gene

Protein Expression for APOBEC3G Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for APOBEC3G Gene

Q9HC16:
  • LGEILRHSMDP
  • FTSWSPC
  • SWSPCTKCTR
  • HETYLCY
  • DPKVTLTIFVARLYYFW
  • SWSPCFSCA
  • GRHAELC
  • PFQPWDGL
  • DYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRE
  • HPEMRFFHWFSKWRKLHRDQE
  • WVRGRHETYLCYEVER
  • WLCYEVK

Post-translational modifications for APOBEC3G Gene

  • Ubiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway.
  • Phosphorylation at Thr-32 reduces its binding to HIV-1 VIF and subsequent ubiquitination and degradation thus promoting its antiviral activity.
  • Ubiquitination at Lys63
  • Modification sites at PhosphoSitePlus

Other Protein References for APOBEC3G Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

Domains & Families for APOBEC3G Gene

Gene Families for APOBEC3G Gene

HGNC:
Human Protein Atlas (HPA):
  • Predicted intracellular proteins

Protein Domains for APOBEC3G Gene

Blocks:
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for APOBEC3G Gene

GenScript: Design optimal peptide antigens:
  • CEM-15 (ABC3G_HUMAN)
  • Apolipoprotein B mRNA editing enzyme (B2LYL6_HUMAN)
  • Apolipoprotein B mRNA editing enzyme cytidine deaminase (F2YHL6_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9HC16

UniProtKB/Swiss-Prot:

ABC3G_HUMAN :
  • The CMP/dCMP deaminase domain 1 mediates RNA binding, RNA-dependent oligomerization and virion incorporation whereas the CMP/dCMP deaminase domain 2 confers deoxycytidine deaminase activity and substrate sequence specificity.
  • Belongs to the cytidine and deoxycytidylate deaminase family.
Domain:
  • The CMP/dCMP deaminase domain 1 mediates RNA binding, RNA-dependent oligomerization and virion incorporation whereas the CMP/dCMP deaminase domain 2 confers deoxycytidine deaminase activity and substrate sequence specificity.
Family:
  • Belongs to the cytidine and deoxycytidylate deaminase family.
genes like me logo Genes that share domains with APOBEC3G: view

Function for APOBEC3G Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for APOBEC3G Gene

UniProtKB/Swiss-Prot Function:
DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 2'-deoxycytidine in a single-stranded DNA + H(+) + H2O = a 2'-deoxyuridine in a single-stranded DNA + NH4(+); Xref=Rhea:RHEA:50948, Rhea:RHEA-COMP:12846, Rhea:RHEA-COMP:12847, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:28938, ChEBI:CHEBI:85452, ChEBI:CHEBI:133902; Evidence={ECO:0000269 PubMed:12808465, ECO:0000269 PubMed:18288108, ECO:0000269 PubMed:18849968, ECO:0000269 PubMed:19153609};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Assembly into ribonucleoprotein complexes of high-molecular-mass (HMM) inhibits its enzymatic activity. Antiviral activity is neutralized by the HIV-1 virion infectivity factor (VIF), that prevents its incorporation into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. Can also be neutralized by simian immunodeficiency virus sooty mangabey monkey virus (SIV-sm) and chimpanzee immunodeficiency virus (SIV-cpz) VIF.
UniProtKB/Swiss-Prot Induction:
Up-regulated by IFN-alpha.

Enzyme Numbers (IUBMB) for APOBEC3G Gene

Phenotypes From GWAS Catalog for APOBEC3G Gene

Gene Ontology (GO) - Molecular Function for APOBEC3G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003723 RNA binding IBA,IDA 11863358
GO:0003824 catalytic activity IEA --
GO:0004126 cytidine deaminase activity TAS 17121840
GO:0005515 protein binding IPI 14528301
GO:0008270 zinc ion binding IDA 11863358
genes like me logo Genes that share ontologies with APOBEC3G: view
genes like me logo Genes that share phenotypes with APOBEC3G: view

Animal Model Products

CRISPR Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for APOBEC3G Gene

Localization for APOBEC3G Gene

Subcellular locations from UniProtKB/Swiss-Prot for APOBEC3G Gene

Cytoplasm. Nucleus. Cytoplasm, P-body. Note=Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for APOBEC3G gene
Compartment Confidence
nucleus 5
cytosol 4

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (1)
  • Nucleoplasm (1)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for APOBEC3G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000932 P-body IDA 16699599
GO:0005634 nucleus IBA 21873635
GO:0005737 cytoplasm IBA,IDA 16527742
GO:0005829 cytosol TAS --
GO:0030895 apolipoprotein B mRNA editing enzyme complex TAS 17121840
genes like me logo Genes that share ontologies with APOBEC3G: view

Pathways & Interactions for APOBEC3G Gene

genes like me logo Genes that share pathways with APOBEC3G: view

Pathways by source for APOBEC3G Gene

1 KEGG pathway for APOBEC3G Gene

SIGNOR curated interactions for APOBEC3G Gene

Is activated by:

Gene Ontology (GO) - Biological Process for APOBEC3G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002230 positive regulation of defense response to virus by host IDA 17121840
GO:0002376 immune system process IEA --
GO:0009972 cytidine deamination IDA 16378963
GO:0010529 negative regulation of transposition IDA 16527742
GO:0016032 viral process IEA --
genes like me logo Genes that share ontologies with APOBEC3G: view

Drugs & Compounds for APOBEC3G Gene

Products:

  1. Drug

(7) Drugs for APOBEC3G Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Ammonia Approved Pharma 0
Water Approved Pharma 0
deoxycytidine Experimental, Investigational Pharma 0
Deoxyuridine Experimental Pharma 6

(3) Additional Compounds for APOBEC3G Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with APOBEC3G: view

Transcripts for APOBEC3G Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for APOBEC3G Gene

(4) REFSEQ mRNAs :
(15) Additional mRNA sequences :
(23) Selected AceView cDNA sequences:
(7) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for APOBEC3G Gene

No ASD Table

Relevant External Links for APOBEC3G Gene

GeneLoc Exon Structure for
APOBEC3G
ECgene alternative splicing isoforms for
APOBEC3G

Expression for APOBEC3G Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for APOBEC3G Gene

mRNA expression in normal human tissues for APOBEC3G Gene
mRNA expression by BioGPS for APOBEC3G GenemRNA expression by GTEx for APOBEC3G Gene

mRNA differential expression in normal tissues according to GTEx for APOBEC3G Gene

This gene is overexpressed in Whole Blood (x8.7).

Protein differential expression in normal tissues from HIPED for APOBEC3G Gene

This gene is overexpressed in Bone marrow stromal cell (28.6), Peripheral blood mononuclear cells (17.2), and NK cells (10.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for APOBEC3G Gene



Protein tissue co-expression partners for APOBEC3G Gene

NURSA nuclear receptor signaling pathways regulating expression of APOBEC3G Gene:

APOBEC3G

SOURCE GeneReport for Unigene cluster for APOBEC3G Gene:

Hs.660143

mRNA Expression by UniProt/SwissProt for APOBEC3G Gene:

Q9HC16-ABC3G_HUMAN
Tissue specificity: Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines. Exists only in the LMM form in peripheral blood-derived resting CD4 T-cells and monocytes, both of which are refractory to HIV-1 infection. LMM is converted to a HMM complex when resting CD4 T-cells are activated or when monocytes are induced to differentiate into macrophages. This change correlates with increased susceptibility of these cells to HIV-1 infection.

Evidence on tissue expression from TISSUES for APOBEC3G Gene

  • Kidney(4.3)
  • Skin(4)
  • Blood(2.7)
  • Lymph node(2.5)
  • Spleen(2.4)
genes like me logo Genes that share expression patterns with APOBEC3G: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for APOBEC3G Gene

Orthologs for APOBEC3G Gene

This gene was present in the common ancestor of mammals.

Orthologs for APOBEC3G Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia APOBEC3G 33 32
  • 98.35 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia APOBEC3A 33
  • 51 (a)
 OneToMany
dog
(Canis familiaris)
 Mammalia -- 33
  • 47 (a)
 ManyToMany
-- 33
  • 31 (a)
 ManyToMany
Species where no ortholog for APOBEC3G was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • lizard (Anolis carolinensis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • mouse (Mus musculus)
  • oppossum (Monodelphis domestica)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rainbow trout (Oncorhynchus mykiss)
  • rat (Rattus norvegicus)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)
  • zebrafish (Danio rerio)

Evolution for APOBEC3G Gene

ENSEMBL:
Gene Tree for APOBEC3G (if available)
TreeFam:
Gene Tree for APOBEC3G (if available)
Aminode:
Evolutionary constrained regions (ECRs) for APOBEC3G: view image

Paralogs for APOBEC3G Gene

Paralogs for APOBEC3G Gene

(11) SIMAP similar genes for APOBEC3G Gene using alignment to 4 proteins:

  • ABC3G_HUMAN
  • B2LYL6_HUMAN
  • F2YHL6_HUMAN
  • M4VSD8_HUMAN

Pseudogenes.org Pseudogenes for APOBEC3G Gene

genes like me logo Genes that share paralogs with APOBEC3G: view

Variants for APOBEC3G Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations from dbSNP and Humsavar for APOBEC3G Gene

SNP ID Clin Chr 22 pos Variation AA Info Type
rs1000243581 -- 39,076,889(+) G/A upstream_transcript_variant
rs1000300520 -- 39,087,386(+) T/G coding_sequence_variant, genic_downstream_transcript_variant, intron_variant, missense_variant
rs1001118858 -- 39,083,496(+) T/C downstream_transcript_variant, genic_downstream_transcript_variant, intron_variant
rs1001583704 -- 39,082,565(+) G/A 3_prime_UTR_variant, intron_variant, non_coding_transcript_variant
rs1001807433 -- 39,087,683(+) G/T 3_prime_UTR_variant, genic_downstream_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for APOBEC3G Gene

Variant ID Type Subtype PubMed ID
esv2724243 CNV deletion 23290073
nsv1066354 CNV gain 25217958
nsv510807 CNV deletion 20534489
nsv589032 CNV loss 21841781
nsv834196 CNV loss 17160897
nsv834197 CNV gain 17160897
nsv955157 CNV deletion 24416366
nsv964631 CNV duplication 23825009

Variation tolerance for APOBEC3G Gene

Residual Variation Intolerance Score: 44.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.70; 57.30% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for APOBEC3G Gene

Human Gene Mutation Database (HGMD)
APOBEC3G
SNPedia medical, phenotypic, and genealogical associations of SNPs for
APOBEC3G

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for APOBEC3G Gene

Disorders for APOBEC3G Gene

MalaCards: The human disease database

(5) MalaCards diseases for APOBEC3G Gene - From: HGMD, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hepatitis b
  • chronic hepatitis b
brain stem infarction
  • brainstem infarction
basilar artery occlusion
human immunodeficiency virus infectious disease
  • hiv infections
human immunodeficiency virus type 1
  • human immunodeficiency virus type 1, susceptibility to
- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for APOBEC3G

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with APOBEC3G: view

No data available for UniProtKB/Swiss-Prot and Genatlas for APOBEC3G Gene

Publications for APOBEC3G Gene

  1. APOBEC3G expression is dysregulated in primary HIV-1 infection and polymorphic variants influence CD4+ T-cell counts and plasma viral load. (PMID: 19996938) Reddy K … CAPRISA Acute Infection Study Team (AIDS (London, England) 2010) 3 23 43 56
  2. Structure, interaction and real-time monitoring of the enzymatic reaction of wild-type APOBEC3G. (PMID: 19153609) Furukawa A … Katahira M (The EMBO journal 2009) 3 4 23 56
  3. Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. (PMID: 18288108) Chen KM … Matsuo H (Nature 2008) 3 4 23 56
  4. Phosphorylation of APOBEC3G by protein kinase A regulates its interaction with HIV-1 Vif. (PMID: 18836454) Shirakawa K … Uchiyama T (Nature structural & molecular biology 2008) 3 4 23 56
  5. [The associations between polymorphisms of APOBEC3G and different outcomes of persistent HBV infection]. (PMID: 18647522) Tian D … Cui JJ (Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2008) 3 23 43 56

ExternalLinks

View latest publications for APOBEC3G gene in Mastermind

Products for APOBEC3G Gene

Sources for APOBEC3G Gene