Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-tr... See more...
Aliases for ALOX5 Gene
Aliases for ALOX5 Gene
External Ids for ALOX5 Gene
- HGNC: 435
- Entrez Gene: 240
- Ensembl: ENSG00000012779
- OMIM: 152390
- UniProtKB: P09917
Previous GeneCards Identifiers for ALOX5 Gene
- GC10P045171
- GC10P045338
- GC10P045644
- GC10P045153
- GC10P045189
- GC10P045869
- GC10P042394
Summaries for ALOX5 Gene
-
This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
GeneCards Summary for ALOX5 Gene
ALOX5 (Arachidonate 5-Lipoxygenase) is a Protein Coding gene. Diseases associated with ALOX5 include Asthma and Atherosclerosis Susceptibility. Among its related pathways are Innate Immune System and HETE and HPETE biosynthesis and metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and arachidonate 5-lipoxygenase activity. An important paralog of this gene is ALOX15B.
UniProtKB/Swiss-Prot Summary for ALOX5 Gene
-
Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
-
Lipoxygenases (LOXs) are a family of non-heme iron dioxygenases that are involved in the production and metabolism of fatty acid hydroperoxidases. There are six lipoxygenase isozymes; 5-LOX, 12R-LOX, 12S-LOX, 15-LOX-1, 15-LOX-2 and E-LOX.
Additional gene information for ALOX5 Gene
- Monarch Initiative
- Search for ALOX5 at DataMed
- Search for ALOX5 at HumanCyc
No data available for CIViC Summary , Rfam classification and piRNA Summary for ALOX5 Gene
Genomics for ALOX5 Gene
GeneHancer (GH) Regulatory Elements for ALOX5 Gene
Promoters and enhancers for ALOX5 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around ALOX5 on UCSC Golden Path with GeneCards custom track
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ALOX5
- Top Transcription factor binding sites by QIAGEN in the ALOX5 gene promoter:
-
- AP-1
- ATF-2
- c-Jun
- Egr-1
- GR
- GR-alpha
- p53
- Sp1
Genomic Locations for ALOX5 Gene
Genomic Locations for ALOX5 Gene
- chr10:45,374,176-45,446,121
- (GRCh38/hg38)
- Size:
- 71,946 bases
- Orientation:
- Plus strand
- chr10:45,869,629-45,941,565
- (GRCh37/hg19)
- Size:
- 71,937 bases
- Orientation:
- Plus strand
Genomic View for ALOX5 Gene
Genes around ALOX5 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 10q11.21 by HGNC
- 10q11.21 by Entrez Gene
- 10q11.21 by Ensembl
ALOX5 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ALOX5 Gene
Proteins for ALOX5 Gene
-
Protein details for ALOX5 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P09917-LOX5_HUMAN
- Recommended name:
- Arachidonate 5-lipoxygenase
- Protein Accession:
- P09917
- B7ZLS0
- E5FPY5
- E5FPY7
- E5FPY8
- Q5JQ14
Protein attributes for ALOX5 Gene
- Size:
- 674 amino acids
- Molecular mass:
- 77983 Da
- Cofactor:
- Name=Fe cation; Xref=ChEBI:CHEBI:24875;
- Cofactor:
- Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
- Quaternary structure:
-
- Interacts with ALOX5AP and LTC4S. Interacts with COTL1, the interaction is required for stability and efficient catalytic activity.
Three dimensional structures from OCA and Proteopedia for ALOX5 Gene
Protein Expression for ALOX5 Gene
Selected DME Specific Peptides for ALOX5 Gene
- P09917:
-
- NHWQEDLMFGYQFLNGCNPVLI
- QFLAAPICLLYKNLANKIVPIAIQLNQ
- SLCFPEAIKARGM
- YRDDGLLVW
- TAKGVVTIEQIV
- HAAVNFGQY
- WVRSSDF
- KLPVTTEMVECSLER
- NPVLIRRC
- ELLDGIDANKTDPCT
- GLFDKANATGGGGHVQMVQRA
- FGYQFLNG
- VIFTASAQHAAVNF
- TLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP
Post-translational modifications for ALOX5 Gene
- Serine phosphorylation by MAPKAPK2 is stimulated by arachidonic acid. Phosphorylation on Ser-523 by PKA has an inhibitory effect. Phosphorylation on Ser-272 prevents export from the nucleus.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for ALOX5 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ Phospho-ALOX5(Ser523) Antibody and Immunotag™ ALOX5 Antibody
- NSJ Bioreagents 5-Lipoxygenase Antibody
-
Creative Biolabs
- Recombinant Anti-Human ALOX5 Antibody
- Recombinant Anti-Human ALOX5 Antibody Fab Fragment
- Rabbit Anti-ALOX5 Recombinant Antibody (CBLQ5-011)
- Mouse Anti-ALOX5 Recombinant Antibody (13j13)
- Mouse Anti-ALOX5 Recombinant Antibody (2C5)
- Mouse Anti-ALOX5 Recombinant Antibody (3F1)
- Hi-Affi™ Recombinant Rabbit Anti-ALOX5 Monoclonal Antibody (DS152AB)
- Mouse Anti-ALOX5 Recombinant Antibody (EP6072(2))
- Mouse Anti-ALOX5 Recombinant Antibody (2C7)
- Mouse Anti-ALOX5 Recombinant Antibody (2D7)
- Rabbit Anti-ALOX5 Recombinant Antibody (G.590.2)
-
Custom Antibody ServicesOriGene Antibodies for ALOX5
- AP05762PU-N
- AP06493PU-N
- AP32220PU-N
- CF806854
- CF806885
- CF806887
- CF807011
- CF807012
- CF807013
- CF807020
- CF807021
- TA302414
- TA309073
- TA321186
- TA321187
- TA326065
- TA336527
- TA336528
- TA343270
- TA348442
- TA806854
- TA806854S
- TA806885
- TA806885S
- TA806887
- TA806887S
- TA807011
- TA807011S
- TA807012
- TA807012S
- TA807013
- TA807013S
- TA807020
- TA807020S
- TA807021
- TA807021S
- Novus Biologicals Antibodies for ALOX5
- Invitrogen Antibodies for ALOX5 (AFLGC-ALOX5)
-
Santa Cruz Biotechnology (SCBT) Antibodies for ALOX5
Protein Products
- Search Origene for MassSpec and Protein Over-expression Lysates for ALOX5
- Origene Custom Protein Services for ALOX5
-
Abcam proteins for ALOX5
Assay Products
- Aviva Systems Biology ALOX5 ELISA Kit (Human) : 96 Wells (OKEH00967)
- Novus Biologicals ELISA Kits for ALOX5
-
Boster Bio ELISA Kits for ALOX5
Domains & Families for ALOX5 Gene
Gene Families for ALOX5 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- FDA approved drug targets
- Predicted intracellular proteins
Protein Domains for ALOX5 Gene
- Blocks:
-
- Lipoxygenase
- Lipoxygenase, LH2 domain
- Mammalian lipoxygenase signature
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for ALOX5 Gene
- GenScript: Design optimal peptide antigens:
-
- Arachidonic 5-lipoxygenase delta-10-13 isoform (E5FPY5_HUMAN)
- Arachidonic 5-lipoxygenase alpha-10 isoform (E5FPY7_HUMAN)
- Arachidonic 5-lipoxygenase delta-p10 isoform (E5FPY8_HUMAN)
- Arachidonate 5-lipoxygenase (LOX5_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P09917- Family:
-
- Belongs to the lipoxygenase family.
Function for ALOX5 Gene
Molecular function for ALOX5 Gene
- UniProtKB/Swiss-Prot Function:
- Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4; Xref=Rhea:RHEA:32307, ChEBI:CHEBI:15377, ChEBI:CHEBI:15379, ChEBI:CHEBI:32395, ChEBI:CHEBI:57463; EC=1.13.11.34; Evidence=. ;.
- GENATLAS Biochemistry:
- arachidonate-5-lipoxygenase,lipid peroxidating enzyme implicated in the pathogenesis of inflammatory disorders as well as membrane remodeling,carcinogenesis,atheroma and asthma formation,involved in leukotriene metabolism
Enzyme Numbers (IUBMB) for ALOX5 Gene
Phenotypes From GWAS Catalog for ALOX5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004051 | arachidonate 5-lipoxygenase activity | TAS | -- |
| GO:0005506 | iron ion binding | IEA,IDA | 21233389 |
| GO:0005515 | protein binding | IPI,IEA | 11297527 |
| GO:0016491 | oxidoreductase activity | IEA | -- |
| GO:0016702 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | IEA | -- |
Phenotypes for ALOX5 Gene
- MGI mutant phenotypes for ALOX5:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for ALOX5:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ALOX5 - Select products 50% OFF >
- * ALOX5 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * ALOX5 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
OriGene CRISPR knockouts for ALOX5
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ALOX5
- genomics-online: gRNA clones - Search for available ALOX5 gRNA products
- Overview of 113 available ALOX5 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for ALOX5
miRNA for ALOX5 Gene
- miRTarBase miRNAs that target ALOX5
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ALOX5
- Browse OriGene Inhibitory RNA Products For ALOX5
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ALOX5
- genomics-online: shRNA clones - Search for available ALOX5 shRNA products
- Overview of 113 available ALOX5 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for ALOX5 - Select products 50% OFF >
- * ALOX5 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * ALOX5 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
-
- RC217259
- RC233017
- RC233049
- RG217259
- RG233017
- RG233049
- MR227106
- MG227106
- RR204994
- RC217259L1
- RC217259L1V
- RC217259L2
- RC217259L2V
- RC217259L3
- RC217259L3V
- RC217259L4
- RC217259L4V
- MR227106L1
- MR227106L1V
- MR227106L2
- MR227106L2V
- MR227106L3
- MR227106L3V
- MR227106L4
- MR227106L4V
- RR204994L3
- RR204994L3V
- RR204994L4
- RR204994L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for ALOX5
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ALOX5
- genomics-online: cdna clones - Search for available ALOX5 CDNA products
- Overview of 113 available ALOX5 gene related products
- orf clones - Search for available ALOX5 ORF products
- Overview of 113 available ALOX5 gene related products
Cell Line Products
-
Horizon Cell Lines for ALOX5
No data available for Transcription Factor Targets and HOMER Transcription for ALOX5 Gene
Localization for ALOX5 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ALOX5 Gene
- Cytoplasm. Nucleus matrix. Nucleus membrane; Peripheral membrane protein. Note=Shuttles between cytoplasm and nucleus. Found exclusively in the nucleus, when phosphorylated on Ser-272. Calcium binding promotes translocation from the cytosol and the nuclear matrix to the nuclear envelope and membrane association.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 5 |
| extracellular | 4 |
| plasma membrane | 2 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| peroxisome | 2 |
| endoplasmic reticulum | 2 |
| lysosome | 2 |
| endosome | 1 |
| golgi apparatus | 1 |
- Nucleoplasm (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005576 | extracellular region | TAS | -- |
| GO:0005615 | extracellular space | HDA | 22664934 |
| GO:0005634 | nucleus | IEA | -- |
| GO:0005635 | nuclear envelope | TAS,IDA | -- |
| GO:0005641 | nuclear envelope lumen | IDA | 8245774 |
Pathways & Interactions for ALOX5 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Arachidonic acid metabolism | ||
| 2 | Metabolism |
.40
|
|
| 3 | Innate Immune System |
.61
|
|
| 4 | HETE and HPETE biosynthesis and metabolism |
HETE and HPETE biosynthesis and metabolism
-
|
|
| 5 | aspirin-triggered lipoxin biosynthesis | ||
Pathways by source for ALOX5 Gene
8 BioSystems pathways for ALOX5 Gene
12 Reactome pathways for ALOX5 Gene
1 PharmGKB pathway for ALOX5 Gene
6 KEGG pathways for ALOX5 Gene
1 GeneGo (Thomson Reuters) pathway for ALOX5 Gene
- HETE and HPETE biosynthesis and metabolism
1 Qiagen pathway for ALOX5 Gene
- all-trans-Retinoic Acid Signaling in Brain
2 Cell Signaling Technology pathways for ALOX5 Gene
UniProtKB/Swiss-Prot P09917-LOX5_HUMAN
- Pathway: Lipid metabolism; leukotriene A4 biosynthesis.
Interacting Proteins for ALOX5 Gene
Selected Interacting proteins:
P09917-LOX5_HUMAN
ENSP00000363512
for ALOX5 Gene via
UniProtKB
STRING
IID
GPS-Prot Interaction Network for ALOX5
SIGNOR curated interactions for ALOX5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0002540 | leukotriene production involved in inflammatory response | IEA | -- |
| GO:0006691 | leukotriene metabolic process | TAS | -- |
| GO:0006954 | inflammatory response | IEA | -- |
| GO:0019221 | cytokine-mediated signaling pathway | TAS | -- |
| GO:0019370 | leukotriene biosynthetic process | IEA,IDA | 21233389 |
Drugs & Compounds for ALOX5 Gene
(111) Drugs for ALOX5 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Zileuton | Approved, Investigational, Withdrawn | Pharma | Inhibition, Inhibitor, inhibitor, Target | 5-lipoxygenase (5-LOX) inhibitor, orally active | 20 | |
| Montelukast | Approved | Pharma | Antagonist, Target, other/unknown | 291 | ||
| Balsalazide | Approved, Investigational | Pharma | inhibitor, Target | 8 | ||
| Meclofenamic acid | Approved, Vet_approved | Pharma | inhibitor, Target | 2 | ||
| Mesalazine | Approved | Pharma | inhibitor, Target | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| 5-Hpete |
|
74581-83-2 | ||||
| 4'-Hydroxydiclofenac |
|
64118-84-9 | ||||
| 5(S)-Hydroperoxyeicosatetraenoic acid |
|
71774-08-8 |
|
|||
| 9(S)-HPODE |
|
|
||||
| Hydroxyzileuton |
|
|
(5) Tocris Compounds for ALOX5 Gene
| Compound | Action | Cas Number |
|---|---|---|
| 2-TEDC | 5-, 12-, 15-Lipoxygenase inhibitor | 132465-10-2 |
| Baicalein | 5- and 12-Lipoxygenase inhibitor | 491-67-8 |
| BAY-X 1005 | Orally active 5-lipoxygenase activating protein (FLAP) inhibitor | 128253-31-6 |
| BW-B 70C | 5-Lipoxygenase inhibitor | 134470-38-5 |
| MK 886 | Inhibitor of 5-lipoxygenase-activating protein (FLAP) | 118414-82-7 |
(10) ApexBio Compounds for ALOX5 Gene
| Compound | Action | Cas Number |
|---|---|---|
| 2-TEDC | 132465-10-2 | |
| BAY-X 1005 | Potent FLAP inhibitor | 128253-31-6 |
| Butein | Protein kinase inhibitor | 487-52-5 |
| BW-B 70C | 5-Lipoxygenase inhibitor,potent and selective | 134470-38-5 |
| Malotilate | Tyrosine kinase inhibitors | 59937-28-9 |
| MK 886 | 118414-82-7 | |
| PD 146176 | 4079-26-9 | |
| U-73122 | 112648-68-7 | |
| Zileuton | 5-lipoxygenase (5-LOX) inhibitor, orally active | 111406-87-2 |
| Zileuton sodium | 5-lipoxygenase and leukotrienes inhibitor | 118569-21-4 |
Transcripts for ALOX5 Gene
mRNA/cDNA for ALOX5 Gene
- 5 REFSEQ mRNAs :
- 20 NCBI additional mRNA sequence :
- 8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000374391 2519 bps (ENST00000374391.7)
- ENST00000475300 446 bps (ENST00000475300.1)
- ENST00000481117 514 bps (ENST00000481117.1)
- ENST00000483623 363 bps (ENST00000483623.2)
- ENST00000493336 636 bps (ENST00000493336.1)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ALOX5 - Select products 50% OFF >
- * ALOX5 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * ALOX5 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
OriGene CRISPR knockouts for ALOX5
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ALOX5
- genomics-online: gRNA clones - Search for available ALOX5 gRNA products
- Overview of 113 available ALOX5 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for ALOX5
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ALOX5
- Browse OriGene Inhibitory RNA Products For ALOX5
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ALOX5
- genomics-online: shRNA clones - Search for available ALOX5 shRNA products
- Overview of 113 available ALOX5 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for ALOX5 - Select products 50% OFF >
- * ALOX5 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * ALOX5 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
-
- RC217259
- RC233017
- RC233049
- RG217259
- RG233017
- RG233049
- MR227106
- MG227106
- RR204994
- RC217259L1
- RC217259L1V
- RC217259L2
- RC217259L2V
- RC217259L3
- RC217259L3V
- RC217259L4
- RC217259L4V
- MR227106L1
- MR227106L1V
- MR227106L2
- MR227106L2V
- MR227106L3
- MR227106L3V
- MR227106L4
- MR227106L4V
- RR204994L3
- RR204994L3V
- RR204994L4
- RR204994L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for ALOX5
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ALOX5
- genomics-online: cdna clones - Search for available ALOX5 CDNA products
- Overview of 113 available ALOX5 gene related products
- orf clones - Search for available ALOX5 ORF products
- Overview of 113 available ALOX5 gene related products
Relevant External Links for ALOX5 Gene
- GeneLoc Exon Structure for
- ALOX5
Expression for ALOX5 Gene
mRNA differential expression in normal tissues according to GTEx for ALOX5 Gene
This gene is overexpressed in Whole Blood (x28.6).
This gene is overexpressed in Lymph node (23.1) and Peripheral blood mononuclear cells (17.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ALOX5 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ALOX5
SOURCE GeneReport for Unigene cluster for ALOX5 Gene:
Hs.89499Evidence on tissue expression from TISSUES for ALOX5 Gene
- Nervous system(4.5)
- Blood(3.3)
- Lung(3)
- Intestine(2.7)
- Bone marrow(2.5)
- Spleen(2.3)
- Heart(2.2)
- Stomach(2.1)
Primer Products
-
OriGene qPCR primer pairs for ALOX5
- genomics-online: primer clones - Search for available ALOX5 Primer products
- Overview of 113 available ALOX5 gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ALOX5 Gene
Orthologs for ALOX5 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | ALOX5 31 30 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | ALOX5 31 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | ALOX5 31 30 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | ALOX5 31 30 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | ALOX5 31 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Alox5 17 31 30 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Alox5 30 |
|
||
| chicken (Gallus gallus) |
Aves | ALOX5 31 30 |
|
OneToOne | |
| lizard (Anolis carolinensis) |
Reptilia | ALOX5 31 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | alox5 30 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | alox5a 31 30 |
|
OneToMany | |
| alox5b.3 31 |
|
OneToMany | |||
| ALOX5 (1 of 4) 31 |
|
OneToMany | |||
| alox5b.2 31 |
|
OneToMany | |||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | LOX5 30 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os03g0699700 30 |
|
||
| corn (Zea mays) |
Liliopsida | Zm.14487 30 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
ManyToMany | |
| CSA.6148 31 |
|
ManyToMany | |||
| -- 31 |
|
ManyToMany | |||
| -- 31 |
|
ManyToMany |
- Species where no ortholog for ALOX5 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Evolution for ALOX5 Gene
- ENSEMBL:
- Gene Tree for ALOX5 (if available)
- TreeFam:
- Gene Tree for ALOX5 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for ALOX5: view image
Paralogs for ALOX5 Gene
Variants for ALOX5 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ALOX5 Gene
| SNP ID | Clinical significance and condition | Chr 10 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs146362560 | Not Provided: not provided | 45,440,444(+) | G/A | SYNONYMOUS_VARIANT | |
| rs179363899 | Not Provided: not provided | 45,443,004(+) | C/T | INTRON_VARIANT | |
| rs869025237 | Uncertain Significance: Ductal breast carcinoma | 45,412,249(+) | T/G | MISSENSE_VARIANT | |
| rs2228065 | - | p.Glu254Lys |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2513283 | CNV | deletion | 19546169 |
| esv2567160 | CNV | deletion | 19546169 |
| esv3891797 | CNV | gain | 25118596 |
| nsv1043536 | CNV | gain | 25217958 |
| nsv466910 | CNV | loss | 19166990 |
| nsv550715 | CNV | loss | 21841781 |
Residual Variation Intolerance Score:
8.22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
2.03;
37.34% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ALOX5 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ALOX5 Gene
Disorders for ALOX5 Gene
(41) MalaCards diseases for ALOX5 Gene - From: OMIM, ClinVar, GTR, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| asthma |
|
|
| atherosclerosis susceptibility |
|
|
| allergic rhinitis |
|
|
| arthus reaction |
|
|
| paranasal sinus disease |
|
|
Search ALOX5 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for ALOX5
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for ALOX5 Gene
Publications for ALOX5 Gene
- 5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci. (PMID: 19214143) Tantisira KG … Weiss ST (Pharmacogenetics and genomics 2009) 3 23 41 54
- Phosphorylation of serine 271 on 5-lipoxygenase and its role in nuclear export. (PMID: 18978352) Flamand N … Brock TG (The Journal of biological chemistry 2009) 3 4 23 54
- Coactosin-like protein functions as a stabilizing chaperone for 5-lipoxygenase: role of tryptophan 102. (PMID: 19807693) Esser J … Rådmark O (The Biochemical journal 2009) 3 4 23 54
- ALOX5 promoter genotype and response to montelukast in moderate persistent asthma. (PMID: 18339529) Telleria JJ … Diez I (Respiratory medicine 2008) 3 23 41 54
- Nutrigenetic association of the 5-lipoxygenase gene with myocardial infarction. (PMID: 18842779) Allayee H … Campos H (The American journal of clinical nutrition 2008) 3 23 41 54
ExternalLinks
Products for ALOX5 Gene
- Custom Antibody ServicesOriGene Antibodies for ALOX5
- AP05762PU-N
- AP06493PU-N
- AP32220PU-N
- CF806854
- CF806885
- CF806887
- CF807011
- CF807012
- CF807013
- CF807020
- CF807021
- TA302414
- TA309073
- TA321186
- TA321187
- TA326065
- TA336527
- TA336528
- TA343270
- TA348442
- TA806854
- TA806854S
- TA806885
- TA806885S
- TA806887
- TA806887S
- TA807011
- TA807011S
- TA807012
- TA807012S
- TA807013
- TA807013S
- TA807020
- TA807020S
- TA807021
- TA807021S
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for ALOX5
- Origene Custom Protein Services for ALOX5
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ALOX5
- Browse OriGene Inhibitory RNA Products For ALOX5
- OriGene qPCR primer pairs for ALOX5
- OriGene CRISPR knockouts for ALOX5
- RC217259
- RC233017
- RC233049
- RG217259
- RG233017
- RG233049
- MR227106
- MG227106
- RR204994
- RC217259L1
- RC217259L1V
- RC217259L2
- RC217259L2V
- RC217259L3
- RC217259L3V
- RC217259L4
- RC217259L4V
- MR227106L1
- MR227106L1V
- MR227106L2
- MR227106L2V
- MR227106L3
- MR227106L3V
- MR227106L4
- MR227106L4V
- RR204994L3
- RR204994L3V
- RR204994L4
- RR204994L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ALOX5
- Sino Biological Human cDNA Clone for ALOX5
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for ALOX5
- Novus Biologicals proteins and lysates for ALOX5
- Novus Biologicals ELISA Kits for ALOX5
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam proteins for ALOX5
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for ALOX5 (AFLGC-ALOX5)
- ApexBio compounds for ALOX5
- antibodies-online: Show 42 available ALOX5 Antibodies ranked by validation data
- Compare Top ALOX5 Antibodies
- antibodies-online: Show 71 available ALOX5 Elisa Kits ranked by validation data
- Compare Top ALOX5 Elisa Kits
- Quality Products:
- antibodies-online: Show 13 available ALOX5 Proteins ranked by validation data
- Compare Top ALOX5 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for ALOX5
- Search Santa Cruz Biotechnology (SCBT) for ALOX5 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ALOX5
- Horizon Cell Lines for ALOX5
- genomics-online: cdna clones - Search for available ALOX5 CDNA products
- Overview of 113 available ALOX5 gene related products
- orf clones - Search for available ALOX5 ORF products
- Overview of 113 available ALOX5 gene related products
- genomics-online: gRNA clones - Search for available ALOX5 gRNA products
- Overview of 113 available ALOX5 gene related products
- genomics-online: primer clones - Search for available ALOX5 Primer products
- Overview of 113 available ALOX5 gene related products
- genomics-online: shRNA clones - Search for available ALOX5 shRNA products
- Overview of 113 available ALOX5 gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ALOX5
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ALOX5
- Search GeneCopoeia for miRNA 3'UTR Target clone products for ALOX5
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ALOX5
Sources for ALOX5 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) H-invDB
- (47) HORDE
- (48) HUGE
- (49) IMGT
- (50) Leiden
- (51) miRBase
- (52) DME
- (53) OriGene
- (54) PubMed
- (55) R&D Systems
- (56) TGDB
- (57) Tocris
- (58) Abcam
- (59) Novus Biologicals
- (60) ProSpec
- (61) Sino Biological
- (62) GenScript
- (63) Qiagen
- (64) OCA
- (65) Proteopedia
- (66) MOPED
- (67) neXtProt
- (68) Reactome
- (69) GeneGo (Thomson Reuters)
- (70) DISEASES
- (71) SIMAP
- (72) GenomeRNAi
- (73) LifeMap
- (74) miRTarBase
- (75) MalaCards
- (76) Invitrogen
- (77) BitterDB
- (78) ESI-BIO
- (79) RefSeq
- (80) BioSystems
- (81) MaxQB
- (82) IUPHAR
- (83) BioGPS
- (84) Illumina
- (85) COMPARTMENTS
- (86) HOMER
- (87) PaxDb
- (88) ApexBio
- (89) Addgene
- (90) antibodies-online
- (91) CYP
- (92) NONCODE
- (93) TreeFam
- (94) PathCards
- (95) GeneReviews
- (96) GeneTex
- (97) Taconic Biosciences
- (98) GTEx
- (99) ProteomicsDB
- (100) SCBT
- (101) DGIdb
- (102) ClinicalTrials
- (103) RVIS
- (104) SIGNOR
- (105) diseasecard
- (106) NIH Rare Diseases
- (107) Orphanet
- (108) UMLS
- (109) GTR
- (110) Disease Ontology
- (111) Genetics Home Reference
- (112) MeSH
- (113) MedlinePlus
- (114) CDC
- (115) NINDS
- (116) NCBI Bookshelf
- (117) ClinVar
- (118) Gene Damage Index
- (119) HPO
- (120) UDN
- (121) VISTA
- (122) FANTOM5
- (123) ENCODE
- (124) ProSci
- (125) Horizon
- (126) The Signaling Pathways Project (SPP)
- (127) IID
- (128) VectorBuilder
- (129) SNPedia
- (130) BRCA Exchange
- (131) CIViC
- (132) ProteoGenix
- (133) dbSUPER
- (134) TISSUES
- (135) Gene ORGANizer
- (136) abm
- (137) Human Protein Atlas
- (138) GWAS Catalog
- (139) Monarch Initiative
- (140) DataMed
- (141) HumanCyc
- (142) genomics-online
- (143) UCNEbase
- (144) EPDnew
- (145) Applied Biosystems
- (146) GlyConnect
- (147) Aminode
- (148) GeneCopoeia
- (149) GPS-Prot
- (150) RNACentral
- (151) LncRNADisease
- (152) LOVD
- (153) miR2Disease
- (154) DiseaseEnhancer
- (155) Boster Bio
- (156) Biorbyt
- (157) Biocompare
- (158) Mastermind
- (159) CTD^2 Dashboard
- (160) CraniofacialAtlas
- (161) GeneImprint
- (162) Synthego
- (163) Bio Basic
- (164) ENA
- (165) GtRNAdb
- (166) LncBase
- (167) LncBook
- (168) LNCipedia
- (169) LncRNAdb
- (170) Modomics
- (171) PDBe
- (172) Rfam
- (173) SILVA
- (174) snOPY
- (175) SRPDB
- (176) GENCODE
- (177) TarBase
- (178) MyBioSource