ALOX5 Gene (Protein Coding)

Arachidonate 5-Lipoxygenase

GC10P045374
GIFtS:
48
This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-tr... See more...

Aliases for ALOX5 Gene

Aliases for ALOX5 Gene

  • Arachidonate 5-Lipoxygenase 2 3 4 5
  • EC 1.13.11.34 4 52
  • 5-LO 3 4
  • LOG5 3 4
  • Arachidonic 5-Lipoxygenase Delta-10-13 Isoform 3
  • Arachidonic 5-Lipoxygenase Delta-P10 Isoform 3
  • Arachidonic 5-Lipoxygenase Alpha-10 Isoform 3
  • Arachidonic 5-Lipoxygenase Delta-13 Isoform 3
  • Arachidonic Acid 5-Lipoxygenase 3
  • Leukotriene A4 Synthase 3
  • 5-Lipoxygenase 4
  • EC 1.13.11 52
  • 5-LOX 3
  • LOX-5 3
  • 5LPG 3

External Ids for ALOX5 Gene

Previous GeneCards Identifiers for ALOX5 Gene

  • GC10P045171
  • GC10P045338
  • GC10P045644
  • GC10P045153
  • GC10P045189
  • GC10P045869
  • GC10P042394

Summaries for ALOX5 Gene

Entrez Gene Summary for ALOX5 Gene

  • This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

GeneCards Summary for ALOX5 Gene

ALOX5 (Arachidonate 5-Lipoxygenase) is a Protein Coding gene. Diseases associated with ALOX5 include Asthma and Atherosclerosis Susceptibility. Among its related pathways are Innate Immune System and HETE and HPETE biosynthesis and metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and arachidonate 5-lipoxygenase activity. An important paralog of this gene is ALOX15B.

UniProtKB/Swiss-Prot Summary for ALOX5 Gene

  • Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.

Tocris Summary for ALOX5 Gene

  • Lipoxygenases (LOXs) are a family of non-heme iron dioxygenases that are involved in the production and metabolism of fatty acid hydroperoxidases. There are six lipoxygenase isozymes; 5-LOX, 12R-LOX, 12S-LOX, 15-LOX-1, 15-LOX-2 and E-LOX.

Gene Wiki entry for ALOX5 Gene

PharmGKB "VIP" Summary for ALOX5 Gene

Additional gene information for ALOX5 Gene

No data available for CIViC Summary , Rfam classification and piRNA Summary for ALOX5 Gene

Genomics for ALOX5 Gene

GeneHancer (GH) Regulatory Elements for ALOX5 Gene

Promoters and enhancers for ALOX5 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH10J045373 Promoter/Enhancer 2 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 514.1 +1.6 1625 6 HNRNPK CTCF ZIC2 ZNF263 RBM34 ZBTB26 CUX1 ZNF740 MYC CTBP1 ALOX5 OR13A1 WASHC2C ZFAND4 piR-33605-051
GH10J045418 Promoter/Enhancer 2.1 FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 24.5 +46.5 46542 5.2 SP1 EP300 ZIC2 POLR2A RELA RCOR1 HDAC2 BCL11A NR2F2 TCF12 ALOX5 AGAP4 LOC102724323 ZFAND4 WASHC2C MARCHF8 OR13A1 piR-53813 lnc-WASHC2C-4
GH10J045408 Enhancer 1 FANTOM5 ENCODE dbSUPER 16.8 +34.9 34933 0.3 ZNF316 ZKSCAN1 PBX2 NFE2 ZNF395 MAFG MEIS2 DACH1 NR4A1 PKNOX1 piR-53813 ALOX5 LOC102724323 WASHC2C piR-56759-046
GH10J045353 Enhancer 1.2 FANTOM5 Ensembl ENCODE 11.3 -20.2 -20176 4 CTCF PHB2 AFF1 REST DNMT1 TOE1 CTBP1 TRIM25 HINFP MIER1 OR13A1 ALOX5 AGAP4 piR-53431-064 piR-55194-039
GH10J045378 Enhancer 1 FANTOM5 ENCODE dbSUPER 13.8 +5.8 5766 2 SPI1 ATF4 POLR2A MAX MYC ATF3 CEBPB FOS EED RUNX3 OR13A1 ALOX5 WASHC2C piR-33605-051
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ALOX5 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ALOX5

Top Transcription factor binding sites by QIAGEN in the ALOX5 gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • Egr-1
  • GR
  • GR-alpha
  • p53
  • Sp1

Genomic Locations for ALOX5 Gene

Genomic Locations for ALOX5 Gene
chr10:45,374,176-45,446,121
(GRCh38/hg38)
Size:
71,946 bases
Orientation:
Plus strand
chr10:45,869,629-45,941,565
(GRCh37/hg19)
Size:
71,937 bases
Orientation:
Plus strand

Genomic View for ALOX5 Gene

Genes around ALOX5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ALOX5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ALOX5 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for ALOX5 Gene

Proteins for ALOX5 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for ALOX5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P09917-LOX5_HUMAN
    Recommended name:
    Arachidonate 5-lipoxygenase
    Protein Accession:
    P09917
    Secondary Accessions:
    • B7ZLS0
    • E5FPY5
    • E5FPY7
    • E5FPY8
    • Q5JQ14

    Protein attributes for ALOX5 Gene

    Size:
    674 amino acids
    Molecular mass:
    77983 Da
    Cofactor:
    Name=Fe cation; Xref=ChEBI:CHEBI:24875;
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Quaternary structure:
    • Interacts with ALOX5AP and LTC4S. Interacts with COTL1, the interaction is required for stability and efficient catalytic activity.

    Three dimensional structures from OCA and Proteopedia for ALOX5 Gene

    Alternative splice isoforms for ALOX5 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ALOX5 Gene

Protein Expression for ALOX5 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for ALOX5 Gene

P09917:
  • NHWQEDLMFGYQFLNGCNPVLI
  • QFLAAPICLLYKNLANKIVPIAIQLNQ
  • SLCFPEAIKARGM
  • YRDDGLLVW
  • TAKGVVTIEQIV
  • HAAVNFGQY
  • WVRSSDF
  • KLPVTTEMVECSLER
  • NPVLIRRC
  • ELLDGIDANKTDPCT
  • GLFDKANATGGGGHVQMVQRA
  • FGYQFLNG
  • VIFTASAQHAAVNF
  • TLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP

Post-translational modifications for ALOX5 Gene

  • Serine phosphorylation by MAPKAPK2 is stimulated by arachidonic acid. Phosphorylation on Ser-523 by PKA has an inhibitory effect. Phosphorylation on Ser-272 prevents export from the nucleus.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for ALOX5 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for ALOX5 Gene

Gene Families for ALOX5 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins

Protein Domains for ALOX5 Gene

Blocks:
  • Lipoxygenase
  • Lipoxygenase, LH2 domain
  • Mammalian lipoxygenase signature
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for ALOX5 Gene

GenScript: Design optimal peptide antigens:
  • Arachidonic 5-lipoxygenase delta-10-13 isoform (E5FPY5_HUMAN)
  • Arachidonic 5-lipoxygenase alpha-10 isoform (E5FPY7_HUMAN)
  • Arachidonic 5-lipoxygenase delta-p10 isoform (E5FPY8_HUMAN)
  • Arachidonate 5-lipoxygenase (LOX5_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P09917

UniProtKB/Swiss-Prot:

LOX5_HUMAN :
  • Belongs to the lipoxygenase family.
Family:
  • Belongs to the lipoxygenase family.
genes like me logo Genes that share domains with ALOX5: view

Function for ALOX5 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for ALOX5 Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4; Xref=Rhea:RHEA:32307, ChEBI:CHEBI:15377, ChEBI:CHEBI:15379, ChEBI:CHEBI:32395, ChEBI:CHEBI:57463; EC=1.13.11.34; Evidence=. ;.
GENATLAS Biochemistry:
arachidonate-5-lipoxygenase,lipid peroxidating enzyme implicated in the pathogenesis of inflammatory disorders as well as membrane remodeling,carcinogenesis,atheroma and asthma formation,involved in leukotriene metabolism

Enzyme Numbers (IUBMB) for ALOX5 Gene

Phenotypes From GWAS Catalog for ALOX5 Gene

Gene Ontology (GO) - Molecular Function for ALOX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004051 arachidonate 5-lipoxygenase activity TAS --
GO:0005506 iron ion binding IEA,IDA 21233389
GO:0005515 protein binding IPI,IEA 11297527
GO:0016491 oxidoreductase activity IEA --
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen IEA --
genes like me logo Genes that share ontologies with ALOX5: view
genes like me logo Genes that share phenotypes with ALOX5: view

Human Phenotype Ontology for ALOX5 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for ALOX5 Gene

MGI Knock Outs for ALOX5:

Animal Model Products

CRISPR Products

miRNA for ALOX5 Gene

miRTarBase miRNAs that target ALOX5

Clone Products

No data available for Transcription Factor Targets and HOMER Transcription for ALOX5 Gene

Localization for ALOX5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ALOX5 Gene

Cytoplasm. Nucleus matrix. Nucleus membrane; Peripheral membrane protein. Note=Shuttles between cytoplasm and nucleus. Found exclusively in the nucleus, when phosphorylated on Ser-272. Calcium binding promotes translocation from the cytosol and the nuclear matrix to the nuclear envelope and membrane association.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ALOX5 gene
Compartment Confidence
nucleus 5
cytosol 5
extracellular 4
plasma membrane 2
cytoskeleton 2
mitochondrion 2
peroxisome 2
endoplasmic reticulum 2
lysosome 2
endosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ALOX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005615 extracellular space HDA 22664934
GO:0005634 nucleus IEA --
GO:0005635 nuclear envelope TAS,IDA --
GO:0005641 nuclear envelope lumen IDA 8245774
genes like me logo Genes that share ontologies with ALOX5: view

Pathways & Interactions for ALOX5 Gene

genes like me logo Genes that share pathways with ALOX5: view

Pathways by source for ALOX5 Gene

1 PharmGKB pathway for ALOX5 Gene
1 GeneGo (Thomson Reuters) pathway for ALOX5 Gene
  • HETE and HPETE biosynthesis and metabolism
1 Qiagen pathway for ALOX5 Gene
  • all-trans-Retinoic Acid Signaling in Brain
2 Cell Signaling Technology pathways for ALOX5 Gene

UniProtKB/Swiss-Prot P09917-LOX5_HUMAN

  • Pathway: Lipid metabolism; leukotriene A4 biosynthesis.

SIGNOR curated interactions for ALOX5 Gene

Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for ALOX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002540 leukotriene production involved in inflammatory response IEA --
GO:0006691 leukotriene metabolic process TAS --
GO:0006954 inflammatory response IEA --
GO:0019221 cytokine-mediated signaling pathway TAS --
GO:0019370 leukotriene biosynthetic process IEA,IDA 21233389
genes like me logo Genes that share ontologies with ALOX5: view

Drugs & Compounds for ALOX5 Gene

Products:

  1. Drug

(111) Drugs for ALOX5 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Zileuton Approved, Investigational, Withdrawn Pharma Inhibition, Inhibitor, inhibitor, Target 5-lipoxygenase (5-LOX) inhibitor, orally active 20
Montelukast Approved Pharma Antagonist, Target, other/unknown 291
Balsalazide Approved, Investigational Pharma inhibitor, Target 8
Meclofenamic acid Approved, Vet_approved Pharma inhibitor, Target 2
Mesalazine Approved Pharma inhibitor, Target 0

(81) Additional Compounds for ALOX5 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
5-Hpete
  • (6E,8Z,11Z,14Z)-5-Hydroperoxyicosatetraenoic acid
  • 5-Hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoic acid
  • 5-Hydroperoxy-(6E,8Z,11Z,14Z)-icosatetraenoic acid
  • 6,8,11,14-Eicosatetraenoic acid 5-hydroperoxide
  • Arachidonic acid 5-hydroperoxide
 74581-83-2
4'-Hydroxydiclofenac
  • (O-(2,6-dichloro-4-hydroxyanilino)Phenyl)acetic acid
  • 4'-Hydroxy diclofenac
  • 4'-OH DCF
  • (O-(2,6-dichloro-4-hydroxyanilino)Phenyl)acetate
  • {2-[(2,6-dichloro-4-hydroxyphenyl)amino]phenyl}acetic acid
 64118-84-9
5(S)-Hydroperoxyeicosatetraenoic acid
  • (5S,6E,8Z,11Z,14Z)-5-Hydroperoxyeicosa-6,8,11,14-tetraenoic acid
  • (5S,6E,8Z,11Z,14Z)-5-Hydroperoxyicosa-6,8,11,14-tetraenoate
  • (5S,6E,8Z,11Z,14Z)-5-Hydroperoxyicosa-6,8,11,14-tetraenoic acid
  • (6E,8Z,11Z,14Z)-(5S)-5-Hydroperoxyeicosa-6,8,11,14-tetraenoate
  • (6E,8Z,11Z,14Z)-(5S)-5-Hydroperoxyeicosa-6,8,11,14-tetraenoic acid
 71774-08-8
9(S)-HPODE
Hydroxyzileuton

(5) Tocris Compounds for ALOX5 Gene

Compound Action Cas Number
2-TEDC 5-, 12-, 15-Lipoxygenase inhibitor 132465-10-2
Baicalein 5- and 12-Lipoxygenase inhibitor 491-67-8
BAY-X 1005 Orally active 5-lipoxygenase activating protein (FLAP) inhibitor 128253-31-6
BW-B 70C 5-Lipoxygenase inhibitor 134470-38-5
MK 886 Inhibitor of 5-lipoxygenase-activating protein (FLAP) 118414-82-7

(10) ApexBio Compounds for ALOX5 Gene

Compound Action Cas Number
2-TEDC 132465-10-2
BAY-X 1005 Potent FLAP inhibitor 128253-31-6
Butein Protein kinase inhibitor 487-52-5
BW-B 70C 5-Lipoxygenase inhibitor,potent and selective 134470-38-5
Malotilate Tyrosine kinase inhibitors 59937-28-9
MK 886 118414-82-7
PD 146176 4079-26-9
U-73122 112648-68-7
Zileuton 5-lipoxygenase (5-LOX) inhibitor, orally active 111406-87-2
Zileuton sodium 5-lipoxygenase and leukotrienes inhibitor 118569-21-4
genes like me logo Genes that share compounds with ALOX5: view

Drug Products

Transcripts for ALOX5 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for ALOX5 Gene

5 REFSEQ mRNAs :
20 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for ALOX5 Gene

No ASD Table

Relevant External Links for ALOX5 Gene

GeneLoc Exon Structure for
ALOX5

Expression for ALOX5 Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for ALOX5 Gene

mRNA expression in normal human tissues for ALOX5 Gene
mRNA expression by BioGPS for ALOX5 GenemRNA expression by GTEx for ALOX5 Gene

mRNA differential expression in normal tissues according to GTEx for ALOX5 Gene

This gene is overexpressed in Whole Blood (x28.6).

Protein differential expression in normal tissues from HIPED for ALOX5 Gene

This gene is overexpressed in Lymph node (23.1) and Peripheral blood mononuclear cells (17.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ALOX5 Gene



Protein tissue co-expression partners for ALOX5 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ALOX5

SOURCE GeneReport for Unigene cluster for ALOX5 Gene:

Hs.89499

Evidence on tissue expression from TISSUES for ALOX5 Gene

  • Nervous system(4.5)
  • Blood(3.3)
  • Lung(3)
  • Intestine(2.7)
  • Bone marrow(2.5)
  • Spleen(2.3)
  • Heart(2.2)
  • Stomach(2.1)
genes like me logo Genes that share expression patterns with ALOX5: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ALOX5 Gene

Orthologs for ALOX5 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ALOX5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia ALOX5 31 30
  • 97.42 (n)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia ALOX5 31
  • 92 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia ALOX5 31 30
  • 90.16 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia ALOX5 31 30
  • 90.11 (n)
 OneToOne
oppossum
(Monodelphis domestica)
 Mammalia ALOX5 31
  • 90 (a)
 OneToOne
mouse
(Mus musculus)
 Mammalia Alox5 17 31 30
  • 87.88 (n)
rat
(Rattus norvegicus)
 Mammalia Alox5 30
  • 86.29 (n)
chicken
(Gallus gallus)
 Aves ALOX5 31 30
  • 76.85 (n)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia ALOX5 31
  • 80 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia alox5 30
  • 71.07 (n)
zebrafish
(Danio rerio)
 Actinopterygii alox5a 31 30
  • 70.18 (n)
 OneToMany
alox5b.3 31
  • 59 (a)
 OneToMany
ALOX5 (1 of 4) 31
  • 58 (a)
 OneToMany
alox5b.2 31
  • 57 (a)
 OneToMany
thale cress
(Arabidopsis thaliana)
 eudicotyledons LOX5 30
  • 44.58 (n)
rice
(Oryza sativa)
 Liliopsida Os03g0699700 30
  • 46.5 (n)
corn
(Zea mays)
 Liliopsida Zm.14487 30
sea squirt
(Ciona savignyi)
 Ascidiacea -- 31
  • 38 (a)
 ManyToMany
CSA.6148 31
  • 35 (a)
 ManyToMany
-- 31
  • 32 (a)
 ManyToMany
-- 31
  • 31 (a)
 ManyToMany
Species where no ortholog for ALOX5 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for ALOX5 Gene

ENSEMBL:
Gene Tree for ALOX5 (if available)
TreeFam:
Gene Tree for ALOX5 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ALOX5: view image

Paralogs for ALOX5 Gene

Paralogs for ALOX5 Gene

(5) SIMAP similar genes for ALOX5 Gene using alignment to 2 proteins:

  • LOX5_HUMAN
  • I0CLG0_HUMAN
genes like me logo Genes that share paralogs with ALOX5: view

Variants for ALOX5 Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ALOX5 Gene

SNP ID Clinical significance and condition Chr 10 pos Variation AA Info Type
rs146362560 Not Provided: not provided 45,440,444(+) G/A SYNONYMOUS_VARIANT
rs179363899 Not Provided: not provided 45,443,004(+) C/T INTRON_VARIANT
rs869025237 Uncertain Significance: Ductal breast carcinoma 45,412,249(+) T/G MISSENSE_VARIANT
rs2228065 - p.Glu254Lys

Additional dbSNP identifiers (rs#s) for ALOX5 Gene

Structural Variations from Database of Genomic Variants (DGV) for ALOX5 Gene

Variant ID Type Subtype PubMed ID
esv2513283 CNV deletion 19546169
esv2567160 CNV deletion 19546169
esv3891797 CNV gain 25118596
nsv1043536 CNV gain 25217958
nsv466910 CNV loss 19166990
nsv550715 CNV loss 21841781

Variation tolerance for ALOX5 Gene

Residual Variation Intolerance Score: 8.22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.03; 37.34% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ALOX5 Gene

Human Gene Mutation Database (HGMD)
ALOX5
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ALOX5

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ALOX5 Gene

Disorders for ALOX5 Gene

MalaCards: The human disease database

(41) MalaCards diseases for ALOX5 Gene - From: OMIM, ClinVar, GTR, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
asthma
  • asthma, susceptibility to
atherosclerosis susceptibility
  • aths
allergic rhinitis
  • alrh
arthus reaction
  • arthus phenomenon
paranasal sinus disease
  • disorder of nasal sinus
- elite association - COSMIC cancer census association via MalaCards
Search ALOX5 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for ALOX5

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with ALOX5: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ALOX5 Gene

Publications for ALOX5 Gene

  1. 5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci. (PMID: 19214143) Tantisira KG … Weiss ST (Pharmacogenetics and genomics 2009) 3 23 41 54
  2. Phosphorylation of serine 271 on 5-lipoxygenase and its role in nuclear export. (PMID: 18978352) Flamand N … Brock TG (The Journal of biological chemistry 2009) 3 4 23 54
  3. Coactosin-like protein functions as a stabilizing chaperone for 5-lipoxygenase: role of tryptophan 102. (PMID: 19807693) Esser J … Rådmark O (The Biochemical journal 2009) 3 4 23 54
  4. ALOX5 promoter genotype and response to montelukast in moderate persistent asthma. (PMID: 18339529) Telleria JJ … Diez I (Respiratory medicine 2008) 3 23 41 54
  5. Nutrigenetic association of the 5-lipoxygenase gene with myocardial infarction. (PMID: 18842779) Allayee H … Campos H (The American journal of clinical nutrition 2008) 3 23 41 54

ExternalLinks

View latest publications for ALOX5 gene in Mastermind

Products for ALOX5 Gene

Sources for ALOX5 Gene