Aliases for ALDH3A1 Gene
Aliases for ALDH3A1 Gene
External Ids for ALDH3A1 Gene
- HGNC: 405
- Entrez Gene: 218
- Ensembl: ENSG00000108602
- OMIM: 100660
- UniProtKB: P30838
Previous HGNC Symbols for ALDH3A1 Gene
- ALDH3
Previous GeneCards Identifiers for ALDH3A1 Gene
- GC17M019747
- GC17M021277
- GC17M019545
- GC17M019803
- GC17M019581
- GC17M019641
- GC17M019020
Summaries for ALDH3A1 Gene
-
Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008]
GeneCards Summary for ALDH3A1 Gene
ALDH3A1 (Aldehyde Dehydrogenase 3 Family Member A1) is a Protein Coding gene. Diseases associated with ALDH3A1 include Breast Adenocarcinoma. Among its related pathways are Phenylalanine metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and aldehyde dehydrogenase (NAD) activity. An important paralog of this gene is ALDH3A2.
UniProtKB/Swiss-Prot for ALDH3A1 Gene
-
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde (Probable). They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (Probable). Oxidizes medium and long chain aldehydes into non-toxic fatty acids (PubMed:1737758). Preferentially oxidizes aromatic aldehyde substrates (PubMed:1737758). Comprises about 50 percent of corneal epithelial soluble proteins (By similarity). May play a role in preventing corneal damage caused by ultraviolet light (By similarity).
Additional gene information for ALDH3A1 Gene
- Monarch Initiative
- Search for ALDH3A1 at DataMed
- Search for ALDH3A1 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ALDH3A1 Gene
Genomics for ALDH3A1 Gene
GeneHancer (GH) Regulatory Elements for ALDH3A1 Gene
Promoters and enhancers for ALDH3A1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around ALDH3A1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the ALDH3A1 gene promoter:
Regulatory Element Products
Genomic Locations for ALDH3A1 Gene
Genomic Locations for ALDH3A1 Gene
- chr17:19,737,984-19,748,943
- (GRCh38/hg38)
- Size:
- 10,960 bases
- Orientation:
- Minus strand
- chr17:19,641,297-19,652,256
- (GRCh37/hg19)
Genomic View for ALDH3A1 Gene
Genes around ALDH3A1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 17p11.2 by Ensembl
- 17p11.2 by Entrez Gene
- 17p11.2 by HGNC
ALDH3A1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ALDH3A1 Gene
Proteins for ALDH3A1 Gene
-
Protein details for ALDH3A1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P30838-AL3A1_HUMAN
- Recommended name:
- Aldehyde dehydrogenase, dimeric NADP-preferring
- Protein Accession:
- P30838
- A8K828
- Q9BT37
Protein attributes for ALDH3A1 Gene
- Size:
- 453 amino acids
- Molecular mass:
- 50395 Da
- Quaternary structure:
-
- Homodimer.
Protein Expression for ALDH3A1 Gene
Selected DME Specific Peptides for ALDH3A1 Gene
- P30838:
-
- VTLELGG
- AGNAVVLKP
- APDYILC
- VVLKPSE
- TLELGGK
- ACRRIAWGKFMNSGQTCVAPDYILCDPSIQ
- GQTCVAPDY
- EKPLALY
- CVRSLEEAIQFI
- SGMGSYHG
Post-translational modifications for ALDH3A1 Gene
Other Protein References for ALDH3A1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for ALDH3A1 (Aldehyde Dehydrogenase 3-A1/ALDH3A1)
-
Custom Antibody ServicesOriGene Antibodies for ALDH3A1
- Novus Biologicals Antibodies for ALDH3A1
-
Abcam antibodies for ALDH3A1
- Invitrogen Antibodies for ALDH3A1
- GeneTex ALDH3A1 antibody for ALDH3A1
-
Custom Antibody ServicesProSci Antibodies for ALDH3A1
-
Santa Cruz Biotechnology (SCBT) Antibodies for ALDH3A1
- Sino Biological Antibodies for ALDH3A1
Protein Products
- R&D Systems Proteins and Enzymes for ALDH3A1 (Aldehyde Dehydrogenase 3-A1/ALDH3A1)
- Search Origene for MassSpec and Protein Over-expression Lysates for ALDH3A1
- Origene Custom Protein Services for ALDH3A1
- Sino Biological Cell Lysates for ALDH3A1
- Sino Biological Recombinant Proteins for ALDH3A1
- ProSpec Recombinant Proteins for ALDH3A1
- Search GeneTex for Proteins for ALDH3A1
-
ProSci Proteins for ALDH3A1
-
Abcam proteins for ALDH3A1
Assay Products
- antibodies-online: Search results for 7 available ALDH3A1 Elisa Kits ranked by validation data
- Compare Top ALDH3A1 Elisa Kits
-
Quality Products:
Domains & Families for ALDH3A1 Gene
Gene Families for ALDH3A1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for ALDH3A1 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for ALDH3A1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P30838- Family:
-
- Belongs to the aldehyde dehydrogenase family.
Function for ALDH3A1 Gene
Molecular function for ALDH3A1 Gene
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: Note=Has a high Km for acetaldehyde.;
- UniProtKB/Swiss-Prot CatalyticActivity:
- An aldehyde + NAD(P)(+) + H(2)O = a carboxylate + NAD(P)H.
- UniProtKB/Swiss-Prot Function:
- ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde (Probable). They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (Probable). Oxidizes medium and long chain aldehydes into non-toxic fatty acids (PubMed:1737758). Preferentially oxidizes aromatic aldehyde substrates (PubMed:1737758). Comprises about 50 percent of corneal epithelial soluble proteins (By similarity). May play a role in preventing corneal damage caused by ultraviolet light (By similarity).
Enzyme Numbers (IUBMB) for ALDH3A1 Gene
Phenotypes From GWAS Catalog for ALDH3A1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004028 | 3-chloroallyl aldehyde dehydrogenase activity | IEA | -- |
| GO:0004029 | aldehyde dehydrogenase (NAD) activity | IDA | 1737758 |
| GO:0004030 | aldehyde dehydrogenase [NAD(P)+] activity | TAS | -- |
| GO:0005515 | protein binding | IPI | 21044950 |
| GO:0008106 | alcohol dehydrogenase (NADP+) activity | IDA | 1737758 |
Phenotypes for ALDH3A1 Gene
- MGI mutant phenotypes for ALDH3A1:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for ALDH3A1:
-
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased human papilloma virus 16 (HPV16) pseudovirus infection
- Increased viability after borna disease (rVSVI9G*/BDVG) virus infection
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased shRNA abundance
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for ALDH3A1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for ALDH3A1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH3A1 gene
- Search ViGene Biosciences for ALDH3A1
CRISPR Products
-
OriGene CRISPR knockouts for ALDH3A1
- genomics-online: gRNA clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
- Applied Biological Materials CRISPR for ALDH3A1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ALDH3A1
- GenScript: Design CRISPR guide RNA sequences for ALDH3A1
miRNA for ALDH3A1 Gene
- miRTarBase miRNAs that target ALDH3A1
miRNA Products
- Search ViGene Biosciences for ALDH3A1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for ALDH3A1
- Browse OriGene Inhibitory RNA Products For ALDH3A1
- genomics-online: shRNA clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH3A1 gene
Clone Products
-
OriGene ORF clones in human for ALDH3A1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for ALDH3A1
- VectorBuilder custom plasmid, inducible vectors for ALDH3A1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ALDH3A1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for ALDH3A1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for ALDH3A1
-
ViGene Biosciences adenoviral particle packaged cDNA for ALDH3A1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for ALDH3A1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH3A1 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ALDH3A1 Gene
Localization for ALDH3A1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ALDH3A1 Gene
- Cytoplasm.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| extracellular | 5 |
| cytosol | 5 |
| endoplasmic reticulum | 4 |
| nucleus | 3 |
| mitochondrion | 2 |
| peroxisome | 1 |
- Cytosol (4)
- Plasma membrane (2)
- Vesicles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005615 | extracellular space | HDA,IDA | 22664934 |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005783 | endoplasmic reticulum | IDA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0005886 | plasma membrane | IDA | -- |
Pathways & Interactions for ALDH3A1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Drug metabolism - cytochrome P450 | ||
| 2 | Phenylalanine metabolism | ||
| 3 | Metabolism |
.37
|
|
| 4 | Cyclophosphamide Pathway, Pharmacodynamics | ||
| 5 | Cytochrome P450 - arranged by substrate type | ||
Pathways by source for ALDH3A1 Gene
4 BioSystems pathways for ALDH3A1 Gene
3 Reactome pathways for ALDH3A1 Gene
2 PharmGKB pathways for ALDH3A1 Gene
9 KEGG pathways for ALDH3A1 Gene
1 GeneGo (Thomson Reuters) pathway for ALDH3A1 Gene
Interacting Proteins for ALDH3A1 Gene
Selected Interacting proteins:
ENSP00000225740
P30838-AL3A1_HUMAN
for ALDH3A1 Gene via
STRING
UniProtKB
IID
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006081 | cellular aldehyde metabolic process | IDA | 1737758 |
| GO:0006805 | xenobiotic metabolic process | TAS | -- |
| GO:0008152 | metabolic process | IEA | -- |
| GO:0055114 | oxidation-reduction process | IDA | 1737758 |
No data available for SIGNOR curated interactions for ALDH3A1 Gene
Drugs & Compounds for ALDH3A1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Aldophosphamide |
|
|||||
| Carboxyphosphamide |
|
|||||
| nadph |
|
53-57-6 | ||||
| 3,4-Dihydroxymandelaldehyde |
|
13023-73-9 |
|
|||
| 3,4-Dihydroxymandelic acid |
|
775-01-9 |
|
Transcripts for ALDH3A1 Gene
mRNA/cDNA for ALDH3A1 Gene
- (9) REFSEQ mRNAs :
- (12) Additional mRNA sequences :
- (377) Selected AceView cDNA sequences:
- (17) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for ALDH3A1 Gene
- Aldehyde dehydrogenase 3 family, member A1:
- Representative Sequences:
CRISPR Products
-
OriGene CRISPR knockouts for ALDH3A1
- genomics-online: gRNA clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
- Applied Biological Materials CRISPR for ALDH3A1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ALDH3A1
- GenScript: Design CRISPR guide RNA sequences for ALDH3A1
miRNA Products
- Search ViGene Biosciences for ALDH3A1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for ALDH3A1
- Browse OriGene Inhibitory RNA Products For ALDH3A1
- genomics-online: shRNA clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH3A1 gene
Clone Products
-
OriGene ORF clones in human for ALDH3A1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for ALDH3A1
- VectorBuilder custom plasmid, inducible vectors for ALDH3A1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ALDH3A1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for ALDH3A1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | ^ | 3a | · | 3b | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b | · | 6c | · | 6d | ^ | 7 | ^ | 8a | · | 8b | · | 8c | · | 8d | · | 8e | ^ | 9a | · | 9b | ^ | 10 | ^ | 11a | · | 11b | · | 11c | · | 11d | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||
| SP15: | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
| SP16: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP17: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP18: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP19: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP20: | - | - |
| ExUns: | 12a | · | 12b | · | 12c | ^ | 13a | · | 13b | · | 13c | ^ | 14a | · | 14b | ^ | 15 | ^ | 16 | ^ | 17a | · | 17b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||||
| SP2: | - | - | - | - | |||||||||||||||||||
| SP3: | - | - | - | - | - | - | |||||||||||||||||
| SP4: | - | - | - | ||||||||||||||||||||
| SP5: | - | - | - | ||||||||||||||||||||
| SP6: | - | - | - | ||||||||||||||||||||
| SP7: | - | ||||||||||||||||||||||
| SP8: | |||||||||||||||||||||||
| SP9: | |||||||||||||||||||||||
| SP10: | |||||||||||||||||||||||
| SP11: | |||||||||||||||||||||||
| SP12: | - | ||||||||||||||||||||||
| SP13: | - | ||||||||||||||||||||||
| SP14: | |||||||||||||||||||||||
| SP15: | |||||||||||||||||||||||
| SP16: | |||||||||||||||||||||||
| SP17: | |||||||||||||||||||||||
| SP18: | |||||||||||||||||||||||
| SP19: | |||||||||||||||||||||||
| SP20: |
Expression for ALDH3A1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Eye (Sensory Organs)
- Keratocyte-like cells(Chan AA et. al. 2013)
- Adult Corneal Basal Epithelial Cells Corneal Epithelium
- Keratocytes Corneal Stroma
- Epithelial Cells (Uncategorized)
- Liver (Hepatobiliary System)
- NULL (Sensory Organs)
- Neural Crest (Gastrulation Derivatives)
-
Fibroblasts
- Keratocytes Corneal Stroma
-
Heart (Cardiovascular System)
- Atrioventricular Node Cells Atrioventricular Node
-
Stomach (Gastrointestinal Tract)
-
Esophagus (Gastrointestinal Tract)
mRNA differential expression in normal tissues according to GTEx for ALDH3A1 Gene
This gene is overexpressed in Esophagus - Mucosa (x28.6), Stomach (x10.1), and Minor Salivary Gland (x4.2).
This gene is overexpressed in Nasal epithelium (33.5), Tonsil (14.7), and Oral epithelium (6.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ALDH3A1 Gene
NURSA nuclear receptor signaling pathways regulating expression of ALDH3A1 Gene:
ALDH3A1SOURCE GeneReport for Unigene cluster for ALDH3A1 Gene:
Hs.531682mRNA Expression by UniProt/SwissProt for ALDH3A1 Gene:
P30838-AL3A1_HUMAN
Tissue specificity:
High levels in stomach, esophagus and lung; low level in the liver and kidney.
Evidence on tissue expression from TISSUES for ALDH3A1 Gene
- Pancreas(4.8)
- Stomach(4.8)
- Eye(4.6)
- Lung(4.6)
- Liver(2)
- Skin(2)
Primer Products
-
OriGene qPCR primer pairs for ALDH3A1
-
OriGene qPCR primer pairs and template standards for ALDH3A1
- genomics-online: primer clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
Gene Expression Assay Products
No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ALDH3A1 Gene
Orthologs for ALDH3A1 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | ALDH3A1 34 33 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | ALDH3A1 34 33 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | ALDH3A1 34 33 |
|
OneToOne | |
| rat (Rattus norvegicus) |
Mammalia | Aldh3a1 33 |
|
||
| mouse (Mus musculus) |
Mammalia | Aldh3a1 16 34 33 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | ALDH3A1 34 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | -- 34 |
|
OneToMany | |
| -- 34 |
|
OneToMany | |||
| chicken (Gallus gallus) |
Aves | ALDH3A2 34 |
|
OneToMany | |
| lizard (Anolis carolinensis) |
Reptilia | -- 34 |
|
OneToMany | |
| zebrafish (Danio rerio) |
Actinopterygii | aldh3a2b 34 |
|
ManyToMany | |
| aldh3a2a 34 |
|
ManyToMany | |||
| aldh3a1 34 |
|
ManyToMany | |||
| rainbow trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.864 33 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | Aldh-III 35 34 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | alh-5 34 |
|
ManyToMany | |
| alh-4 34 |
|
ManyToMany | |||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | HFD1 34 36 |
|
OneToMany | |
| thale cress (Arabidopsis thaliana) |
eudicotyledons | ALDH3H1 33 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os11g0186200 33 |
|
||
| Os.5577 33 |
|
||||
| barley (Hordeum vulgare) |
Liliopsida | Hv.4281 33 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.6683 34 |
|
ManyToMany | |
| CSA.9635 34 |
|
ManyToMany |
- Species where no ortholog for ALDH3A1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- tropical clawed frog (Silurana tropicalis)
- wheat (Triticum aestivum)
Paralogs for ALDH3A1 Gene
(5) SIMAP similar genes for ALDH3A1 Gene using alignment to 10 proteins:
Variants for ALDH3A1 Gene
| SNP ID | Clin | Chr 17 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000049285 | -- | 19,749,241(-) | T/C | upstream_transcript_variant | |
| rs1000222912 | -- | 19,744,520(-) | C/T | genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant | |
| rs1000557126 | -- | 19,750,189(-) | G/A | upstream_transcript_variant | |
| rs1000858181 | -- | 19,745,177(-) | G/A/C | 5_prime_UTR_variant, genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant | |
| rs1001077516 | -- | 19,750,384(-) | C/G | upstream_transcript_variant |
Residual Variation Intolerance Score:
95.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
10.44;
90.95% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ALDH3A1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- ALDH3A1
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ALDH3A1 Gene
Disorders for ALDH3A1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| breast adenocarcinoma |
|
|
Search ALDH3A1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for ALDH3A1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for ALDH3A1 Gene
Publications for ALDH3A1 Gene
- Human stomach aldehyde dehydrogenase cDNA and genomic cloning, primary structure, and expression in Escherichia coli. (PMID: 1737758) Hsu LC … Yoshida A (The Journal of biological chemistry 1992) 2 3 4 22 58
- Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide. (PMID: 18496131) Ekhart C … Huitema AD (Pharmacogenetics and genomics 2008) 3 22 44 58
- Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin. (PMID: 18854779) Ekhart C … Huitema AD (Pharmacogenetics and genomics 2008) 3 22 44 58
- Mutations associated with Sjögren-Larsson syndrome. (PMID: 9250352) Tsukamoto N … Yoshida A (Annals of human genetics 1997) 3 4 22 58
- Human stomach aldehyde dehydrogenase, ALDH3. (PMID: 8493892) Hsu LC … Yoshida A (Advances in experimental medicine and biology 1993) 3 4 22 58
Products for ALDH3A1 Gene
- R&D Systems Antibodies for ALDH3A1 (Aldehyde Dehydrogenase 3-A1/ALDH3A1)
- R&D Systems Proteins and Enzymes for ALDH3A1 (Aldehyde Dehydrogenase 3-A1/ALDH3A1)
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for ALDH3A1
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for ALDH3A1
- Origene Custom Protein Services for ALDH3A1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ALDH3A1
- Browse OriGene Inhibitory RNA Products For ALDH3A1
- OriGene qPCR primer pairs and template standards for ALDH3A1
- OriGene qPCR primer pairs for ALDH3A1
- OriGene CRISPR knockouts for ALDH3A1
- OriGene ORF clones in human for ALDH3A1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ALDH3A1
- GenScript: Next-day shipping of latest version cDNA ORF clones for ALDH3A1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for ALDH3A1
- GenScript Custom Assay Services for ALDH3A1
- GenScript Custom overexpressing Cell Line Services for ALDH3A1
- GenScript: Design CRISPR guide RNA sequences for ALDH3A1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for ALDH3A1
- Sino Biological Human cDNA Clone for ALDH3A1
- Sino Biological Recombinant Proteins for ALDH3A1
- Sino Biological Cell Lysates for ALDH3A1
- Sino Biological Antibodies for ALDH3A1
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for ALDH3A1
- Novus Biologicals lysates and proteins for ALDH3A1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for ALDH3A1
- Abcam proteins for ALDH3A1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for ALDH3A1
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Cyagen custom Knockout/knockin (KOKI) mouse models for ALDH3A1
- VectorBuilder custom plasmid, inducible vectors for ALDH3A1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ALDH3A1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 107 available ALDH3A1 Antibodies ranked by validation data
- Compare Top ALDH3A1 Antibodies
- antibodies-online: Search results for 7 available ALDH3A1 Elisa Kits ranked by validation data
- Compare Top ALDH3A1 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 21 available ALDH3A1 Proteins ranked by validation data
- Compare Top ALDH3A1 Proteins
- GeneTex ALDH3A1 antibody for ALDH3A1
- Search GeneTex for Proteins for ALDH3A1
- ViGene Biosciences adenoviral particle packaged cDNA for ALDH3A1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for ALDH3A1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for ALDH3A1 gene
- Search ViGene Biosciences for ALDH3A1
- Santa Cruz Biotechnology (SCBT) Antibodies for ALDH3A1
- Search Santa Cruz Biotechnology (SCBT) for ALDH3A1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ALDH3A1
- Custom Antibody ServicesProSci Antibodies for ALDH3A1
- ProSci Proteins for ALDH3A1
- Horizon Cell Lines for ALDH3A1
- genomics-online: cdna clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
- orf clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
- genomics-online: gRNA clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
- genomics-online: primer clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
- genomics-online: shRNA clones - Search results for 152 available ALDH3A1 gene related products
- Overview of 152 available ALDH3A1 gene related products
Sources for ALDH3A1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems
