S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the diffe... See more...

Aliases for AHCY Gene

Aliases for AHCY Gene

  • Adenosylhomocysteinase 2 3 4 5
  • S-Adenosyl-L-Homocysteine Hydrolase 3 4
  • S-Adenosylhomocysteine Hydrolase 2 3
  • EC 3.3.1.1 4 54
  • AdoHcyase 3 4
  • SAHH 3 4
  • Epididymis Secretory Sperm Binding Protein 3

External Ids for AHCY Gene

Previous GeneCards Identifiers for AHCY Gene

  • GC20M032626
  • GC20M033491
  • GC20M033583
  • GC20M032331
  • GC20M032868
  • GC20M029649
  • GC20M034280
  • GC20M034237

Summaries for AHCY Gene

Entrez Gene Summary for AHCY Gene

  • S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2009]

GeneCards Summary for AHCY Gene

AHCY (Adenosylhomocysteinase) is a Protein Coding gene. Diseases associated with AHCY include Hypermethioninemia With S-Adenosylhomocysteine Hydrolase Deficiency and Hypermethioninemia. Among its related pathways are Viral mRNA Translation and Selenium Micronutrient Network. Gene Ontology (GO) annotations related to this gene include identical protein binding and adenyl nucleotide binding. An important paralog of this gene is AHCYL1.

UniProtKB/Swiss-Prot Summary for AHCY Gene

  • Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.

Additional gene information for AHCY Gene

No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for AHCY Gene

Genomics for AHCY Gene

GeneHancer (GH) Regulatory Elements for AHCY Gene

Promoters and enhancers for AHCY Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around AHCY on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the AHCY gene promoter:
  • aMEF-2
  • AP-4
  • C/EBPalpha
  • COMP1
  • GATA-3
  • MEF-2A
  • POU2F1
  • POU2F1a

Genomic Locations for AHCY Gene

Genomic Locations for AHCY Gene
chr20:34,234,840-34,311,976
(GRCh38/hg38)
Size:
77,137 bases
Orientation:
Minus strand
chr20:32,868,071-32,899,608
(GRCh37/hg19)
Size:
31,538 bases
Orientation:
Minus strand

Genomic View for AHCY Gene

Genes around AHCY on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
AHCY Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for AHCY Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for AHCY Gene

Proteins for AHCY Gene

  • Protein details for AHCY Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P23526-SAHH_HUMAN
    Recommended name:
    Adenosylhomocysteinase
    Protein Accession:
    P23526
    Secondary Accessions:
    • A8K307
    • B3KUN3
    • E1P5P2
    • F5H737
    • Q96A36

    Protein attributes for AHCY Gene

    Size:
    432 amino acids
    Molecular mass:
    47716 Da
    Cofactor:
    Name=NAD(+); Xref=ChEBI:CHEBI:57540;
    Quaternary structure:
    • Homotetramer.

    Three dimensional structures from OCA and Proteopedia for AHCY Gene

    Alternative splice isoforms for AHCY Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for AHCY Gene

Selected DME Specific Peptides for AHCY Gene

P23526:
  • AVVAGYGDVGKG
  • CNIGHFD
  • DGIKRATD
  • IKRATDVM
  • GRLVNLG
  • RATDVMIAGK
  • GARVIITE
  • LPKKLDE
  • TKSKFDNLYGCRESL
  • NIKPQVD
  • YSASKPLKG
  • GHFDVEI
  • KPQVDRY
  • EETTTGV
  • AQIELWT
  • GYGDVGKGCA
  • EGRLVNL
  • LDDGGDLT
  • LKVPAIN
  • GHPSFVMSNSF
  • ITEIDPI
  • NMILDDGGD
  • PLKGARI
  • NVNDSVTK
  • WCIEQTL
  • DVKWLNENAV
  • AWKGETDEEY
  • DPINALQA
  • AGKVAVV
  • DKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRE
  • GARIAGCLHMT
  • EGNIFVT
  • ALQAAMEG
  • IFVTTTG
  • SCNIFSTQ

Post-translational modifications for AHCY Gene

  • Ubiquitination at Lys8, Lys20, Lys166, Lys188, Lys226, and Lys412
  • Modification sites at PhosphoSitePlus

Antibody Products

Domains & Families for AHCY Gene

Gene Families for AHCY Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for AHCY Gene

GenScript: Design optimal peptide antigens:
  • Adenosylhomocysteinase (F5H737_HUMAN)
  • Adenosylhomocysteinase (Q1RMG2_HUMAN)
  • S-adenosyl-L-homocysteine hydrolase (SAHH_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P23526

UniProtKB/Swiss-Prot:

SAHH_HUMAN :
  • Belongs to the adenosylhomocysteinase family.
Family:
  • Belongs to the adenosylhomocysteinase family.
genes like me logo Genes that share domains with AHCY: view

Function for AHCY Gene

Molecular function for AHCY Gene

UniProtKB/Swiss-Prot Function:
Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=H2O + S-adenosyl-L-homocysteine = adenosine + L-homocysteine; Xref=Rhea:RHEA:21708, ChEBI:CHEBI:15377, ChEBI:CHEBI:16335, ChEBI:CHEBI:57856, ChEBI:CHEBI:58199; EC=3.3.1.1;.
GENATLAS Biochemistry:
S-adenosyl-homocysteine hydrolase,sulfur aminoacid metabolism,transmethylation pathway

Enzyme Numbers (IUBMB) for AHCY Gene

Phenotypes From GWAS Catalog for AHCY Gene

Gene Ontology (GO) - Molecular Function for AHCY Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004013 adenosylhomocysteinase activity TAS,IBA 2596825
GO:0005515 protein binding IPI 25416956
GO:0016787 hydrolase activity IEA --
GO:0030554 adenyl nucleotide binding IEA --
GO:0042802 identical protein binding IEA --
genes like me logo Genes that share ontologies with AHCY: view
genes like me logo Genes that share phenotypes with AHCY: view

Human Phenotype Ontology for AHCY Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for AHCY Gene

MGI Knock Outs for AHCY:
  • Ahcy Ahcy<tm1b(EUCOMM)Hmgu>

Animal Model Products

CRISPR Products

Clone Products

  • Addgene plasmids for AHCY

No data available for Transcription Factor Targets and HOMER Transcription for AHCY Gene

Localization for AHCY Gene

Subcellular locations from UniProtKB/Swiss-Prot for AHCY Gene

Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for AHCY gene
Compartment Confidence
cytosol 5
nucleus 3
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for AHCY Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0042470 melanosome IEA --
GO:0043005 neuron projection IEA --
genes like me logo Genes that share ontologies with AHCY: view

Pathways & Interactions for AHCY Gene

genes like me logo Genes that share pathways with AHCY: view

Pathways by source for AHCY Gene

1 GeneGo (Thomson Reuters) pathway for AHCY Gene
1 Qiagen pathway for AHCY Gene
  • Aldosterone Signaling in Epithelial Cells

UniProtKB/Swiss-Prot P23526-SAHH_HUMAN

  • Pathway: Amino-acid biosynthesis; L-homocysteine biosynthesis; L-homocysteine from S-adenosyl-L-homocysteine: step 1/1.

Gene Ontology (GO) - Biological Process for AHCY Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000096 sulfur amino acid metabolic process TAS --
GO:0001666 response to hypoxia IEA --
GO:0002439 chronic inflammatory response to antigenic stimulus IEA --
GO:0006730 one-carbon metabolic process IEA --
GO:0007584 response to nutrient IEA --
genes like me logo Genes that share ontologies with AHCY: view

No data available for SIGNOR curated interactions for AHCY Gene

Drugs & Compounds for AHCY Gene

(28) Drugs for AHCY Gene - From: DrugBank, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Isopropyl alcohol Approved, Investigational Pharma Target 0
Copper Approved, Investigational Pharma Target, allosteric modulator 227
Adenosine Approved, Investigational Pharma Agonist, Channel blocker 627
Water Approved Pharma 0
D-Eritadenine Experimental Pharma Target 0

(20) Additional Compounds for AHCY Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
homocysteine
  • 2-amino-4-Mercaptobutyric acid
  • Hcy
  • 2-amino-4-Mercaptobutyrate
  • (+-)-Homocysteine
  • (S)-2-amino-4-mercapto-Butanoate
454-29-5
s-adenosylmethionine
  • (3S)-5'-[(3-amino-3-Carboxypropyl)methylsulfonio]-5'-deoxyadenosine, inner salt
  • [1-(Adenin-9-yl)-1,5-dideoxy-beta-D-ribofuranos-5-yl][(3S)-3-amino-3-carboxypropyl](methyl)sulfonium
  • Acylcarnitine
  • AdoMet
  • S-(5'-Deoxyadenosin-5'-yl)-L-methionine
485-80-3
Se-Adenosylselenohomocysteine
Selenohomocysteine
  • 2-amino-4-Selanyl-butanoate
  • 2-amino-4-Selanyl-butanoic acid
  • Se-selenocysteine
29412-93-9
genes like me logo Genes that share compounds with AHCY: view

Transcripts for AHCY Gene

CRISPR Products

Clone Products

  • Addgene plasmids for AHCY

Alternative Splicing Database (ASD) splice patterns (SP) for AHCY Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14
SP1: - - - -
SP2: - - - -
SP3: -
SP4: - -
SP5:
SP6: - - -
SP7: - -
SP8: -

Relevant External Links for AHCY Gene

GeneLoc Exon Structure for
AHCY
ECgene alternative splicing isoforms for
AHCY

Expression for AHCY Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for AHCY Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for AHCY Gene



Protein tissue co-expression partners for AHCY Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of AHCY Gene:

AHCY

SOURCE GeneReport for Unigene cluster for AHCY Gene:

Hs.388004

Evidence on tissue expression from TISSUES for AHCY Gene

  • Liver(4.9)
  • Nervous system(4.9)
  • Skin(4.8)
  • Blood(4.6)
  • Kidney(4.4)
  • Intestine(3.8)
  • Lung(3.8)
  • Eye(3.4)
  • Heart(2.3)
  • Muscle(2.2)
  • Spleen(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for AHCY Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • cardiovascular
  • nervous
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • brain
  • ear
  • face
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • skull
  • tooth
Thorax:
  • heart
  • heart valve
genes like me logo Genes that share expression patterns with AHCY: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for AHCY Gene

Orthologs for AHCY Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for AHCY Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia AHCY 33 32
  • 99.69 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Gm4737 33
  • 97 (a)
OneToMany
Ahcy 17 33 32
  • 91.2 (n)
cow
(Bos Taurus)
Mammalia AHCY 33 32
  • 92.44 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia AHCY 33
  • 92 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ahcy 32
  • 91.36 (n)
dog
(Canis familiaris)
Mammalia AHCY 33 32
  • 86.88 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia AHCY 33
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves AHCY 33 32
  • 80.86 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia AHCY 33
  • 89 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ahcy 32
  • 78.24 (n)
Str.6107 32
African clawed frog
(Xenopus laevis)
Amphibia Xl.937 32
zebrafish
(Danio rerio)
Actinopterygii ahcy 33 32 32
  • 78.86 (n)
OneToOne
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8276 32
fruit fly
(Drosophila melanogaster)
Insecta Ahcy13 33 34 32
  • 76.07 (n)
ManyToMany
African malaria mosquito
(Anopheles gambiae)
Insecta SAHH_ANOGA 32
  • 75.6 (n)
worm
(Caenorhabditis elegans)
Secernentea dpy-14 34
  • 76 (a)
ahcy-1 33 32
  • 70.01 (n)
OneToMany
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AFR243C 32
  • 69.95 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SAH1 35 33 32
  • 64.87 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0A01199g 32
  • 64.79 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons MEE58 32
  • 62.36 (n)
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.757 32
rice
(Oryza sativa)
Liliopsida Os11g0455500 32
  • 66.28 (n)
Os.8240 32
barley
(Hordeum vulgare)
Liliopsida Hv.3364 32
wheat
(Triticum aestivum)
Liliopsida Ta.1258 32
corn
(Zea mays)
Liliopsida Zm.10189 32
bread mold
(Neurospora crassa)
Ascomycetes NCU07930 32
  • 71.99 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes SPBC8D2.18c 32
  • 68.54 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 33
  • 68 (a)
ManyToMany
Cin.5073 32
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5073 32
Species where no ortholog for AHCY was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for AHCY Gene

ENSEMBL:
Gene Tree for AHCY (if available)
TreeFam:
Gene Tree for AHCY (if available)
Aminode:
Evolutionary constrained regions (ECRs) for AHCY: view image

Paralogs for AHCY Gene

Paralogs for AHCY Gene

(2) SIMAP similar genes for AHCY Gene using alignment to 2 proteins:

  • SAHH_HUMAN
  • Q1RMG2_HUMAN
genes like me logo Genes that share paralogs with AHCY: view

Variants for AHCY Gene

Sequence variations from dbSNP and Humsavar for AHCY Gene

SNP ID Clin Chr 20 pos Variation AA Info Type
rs121918607 pathogenic, Hypermethioninemia with s-adenosylhomocysteine hydrolase deficiency 34,292,467(-) C/T 5_prime_UTR_variant, coding_sequence_variant, stop_gained
rs121918608 pathogenic, likely-pathogenic, Hypermethioninemia with s-adenosylhomocysteine hydrolase deficiency, not provided, Inborn genetic diseases, Rhabdomyolysis, Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752] 34,292,375(-) T/C coding_sequence_variant, missense_variant
rs13043752 benign, Hypermethioninemia with s-adenosylhomocysteine hydrolase deficiency, - 34,295,502(-) G/A 5_prime_UTR_variant, coding_sequence_variant, missense_variant
rs13245 likely-benign, Hypermethioninemia 34,280,733(-) A/C/G 3_prime_UTR_variant, intron_variant
rs1348839036 uncertain-significance, Hypermethioninemia with s-adenosylhomocysteine hydrolase deficiency 34,290,729(-) A/C splice_donor_variant

Structural Variations from Database of Genomic Variants (DGV) for AHCY Gene

Variant ID Type Subtype PubMed ID
nsv1059756 CNV gain 25217958
nsv1131586 CNV deletion 24896259
nsv3358 CNV deletion 18451855
nsv965872 CNV duplication 23825009

Variation tolerance for AHCY Gene

Residual Variation Intolerance Score: 30.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.32; 41.34% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for AHCY Gene

Human Gene Mutation Database (HGMD)
AHCY
SNPedia medical, phenotypic, and genealogical associations of SNPs for
AHCY

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for AHCY Gene

Disorders for AHCY Gene

MalaCards: The human disease database

(9) MalaCards diseases for AHCY Gene - From: HGMD, LncRNADisease, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hypermethioninemia with s-adenosylhomocysteine hydrolase deficiency
  • hypermethioninemia with deficiency of s-adenosylhomocysteine hydrolase
hypermethioninemia
  • mat deficiency
endometrial cancer
  • endometrial cancer, familial
copper deficiency myelopathy
  • human swayback
adenosine deaminase deficiency
  • severe combined immunodeficiency, autosomal recessive, t cell-negative, b cell-negative, nk cell-negative, due to adenosine deaminase deficiency
- elite association - COSMIC cancer census association via MalaCards
Search AHCY in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

SAHH_HUMAN
  • Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752]: A metabolic disorder characterized by hypermethioninemia associated with failure to thrive, mental and motor retardation, facial dysmorphism with abnormal hair and teeth, and myocardiopathy. {ECO:0000269 PubMed:15024124, ECO:0000269 PubMed:16736098, ECO:0000269 PubMed:19177456, ECO:0000269 PubMed:20852937}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for AHCY

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with AHCY: view

No data available for Genatlas for AHCY Gene

Publications for AHCY Gene

  1. Effect of genetic variation in the human S-adenosylhomocysteine hydrolase gene on total homocysteine concentrations and risk of recurrent venous thrombosis. (PMID: 15241484) Gellekink H … Blom HJ (European journal of human genetics : EJHG 2004) 3 4 23 43 56
  2. S-adenosylhomocysteine hydrolase deficiency in a human: a genetic disorder of methionine metabolism. (PMID: 15024124) Baric I … Mudd SH (Proceedings of the National Academy of Sciences of the United States of America 2004) 3 4 23 56
  3. Catalytic strategy of S-adenosyl-L-homocysteine hydrolase: transition-state stabilization and the avoidance of abortive reactions. (PMID: 12590576) Yang X … Schowen RL (Biochemistry 2003) 3 4 23 56
  4. Limited proteolysis of S-adenosylhomocysteine hydrolase: implications for the three-dimensional structure. (PMID: 7786017) Gupta RA … Borchardt RT (Archives of biochemistry and biophysics 1995) 3 4 23 56
  5. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 43 56

Products for AHCY Gene