NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM, Jul 2002] See more...

Aliases for AGTPBP1 Gene

Aliases for AGTPBP1 Gene

  • ATP/GTP Binding Protein 1 2 3 5
  • Cytosolic Carboxypeptidase 1 2 3 4
  • Nervous System Nuclear Protein Induced By Axotomy Protein 1 Homolog 3 4
  • Tubulinyl-Tyr Carboxypeptidase 2 3
  • Tyrosine Carboxypeptidase 2 3
  • Carboxypeptidase-Tubulin 2 3
  • Soluble Carboxypeptidase 2 3
  • CCP1 3 4
  • NNA1 3 4
  • ATP/GTP-Binding Protein 1 4
  • EC 3.4.17.- 4
  • EC 3.4.17 54
  • KIAA1035 4
  • CONDCA 3

External Ids for AGTPBP1 Gene

Previous GeneCards Identifiers for AGTPBP1 Gene

  • GC09M079205
  • GC09M080014
  • GC09M081716
  • GC09M083618
  • GC09M085391
  • GC09M087351
  • GC09M088161
  • GC09M057985

Summaries for AGTPBP1 Gene

Entrez Gene Summary for AGTPBP1 Gene

  • NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM, Jul 2002]

GeneCards Summary for AGTPBP1 Gene

AGTPBP1 (ATP/GTP Binding Protein 1) is a Protein Coding gene. Diseases associated with AGTPBP1 include Neurodegeneration, Childhood-Onset, With Cerebellar Atrophy. Among its related pathways are Neuroscience. Gene Ontology (GO) annotations related to this gene include binding and metallocarboxypeptidase activity. An important paralog of this gene is AGBL1.

UniProtKB/Swiss-Prot Summary for AGTPBP1 Gene

  • Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins (PubMed:30420557). Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5.

Additional gene information for AGTPBP1 Gene

No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for AGTPBP1 Gene

Genomics for AGTPBP1 Gene

GeneHancer (GH) Regulatory Elements for AGTPBP1 Gene

Promoters and enhancers for AGTPBP1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH09J085740 Promoter/Enhancer 2.4 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 764.4 -0.3 -272 5 ZNF785 SP1 ZBTB6 POLR2A USF2 CTBP1 ZNF362 MYC HLF L3MBTL2 AGTPBP1 lnc-NAA35-11 ENSG00000229454 ENSG00000233713 ENSG00000270688 RN7SKP264 ENSG00000235819 ENSG00000232211 ENSG00000165121 LOC100419824
GH09J085699 Enhancer 0.8 Ensembl dbSUPER 24.6 +38.2 38229 8.8 CTBP1 MAFK PRDM1 ZXDB OSR2 ZNF580 PRDM4 KLF8 ZNF18 OVOL3 AGTPBP1 lnc-GOLM1-2 piR-48222-364
GH09J085715 Enhancer 0.7 FANTOM5 dbSUPER 17.2 +27.7 27674 0.2 ZBTB6 ZSCAN5C SCRT1 ZNF18 ZNF513 PRDM6 AGTPBP1 piR-48222-364 lnc-GOLM1-2
GH09J085714 Enhancer 0.9 ENCODE dbSUPER 13.1 +25.9 25910 3.2 ZBTB6 MLLT1 PRDM1 IKZF1 IKZF2 CTCF SCRT2 ZSCAN5C EED DPF2 AGTPBP1 piR-48222-364 lnc-GOLM1-2
GH09J085536 Enhancer 1 Ensembl ENCODE dbSUPER 10.3 +206.6 206629 8 TRIM22 HLF HDGF CREB1 TARDBP ZSCAN4 MNT ZBTB20 ZNF207 ZKSCAN1 HSALNG0072353 AGTPBP1 LOC101927603 HSALNG0072352
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around AGTPBP1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the AGTPBP1 gene promoter:
  • aMEF-2
  • En-1
  • FOXJ2
  • FOXJ2 (long isoform)
  • MEF-2A
  • Pax-4a
  • Pbx1a
  • POU3F2
  • POU3F2 (N-Oct-5a)
  • POU3F2 (N-Oct-5b)

Genomic Locations for AGTPBP1 Gene

Genomic Locations for AGTPBP1 Gene
chr9:85,546,539-85,742,029
(GRCh38/hg38)
Size:
195,491 bases
Orientation:
Minus strand
chr9:88,161,454-88,356,944
(GRCh37/hg19)
Size:
195,491 bases
Orientation:
Minus strand

Genomic View for AGTPBP1 Gene

Genes around AGTPBP1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
AGTPBP1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for AGTPBP1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for AGTPBP1 Gene

Proteins for AGTPBP1 Gene

  • Protein details for AGTPBP1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UPW5-CBPC1_HUMAN
    Recommended name:
    Cytosolic carboxypeptidase 1
    Protein Accession:
    Q9UPW5
    Secondary Accessions:
    • B4DIT6
    • B4DRZ8
    • Q5VV80
    • Q63HM7
    • Q658P5
    • Q6P9D6
    • Q9H8U6
    • Q9H9W8
    • Q9NVK1

    Protein attributes for AGTPBP1 Gene

    Size:
    1226 amino acids
    Molecular mass:
    138448 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Interacts with MYLK.
    SequenceCaution:
    • Sequence=BAA82987.2; Type=Frameshift; Positions=10; Evidence={ECO:0000305}; Sequence=BAB14100.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=BAB14505.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=BAG61460.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=CAH56222.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=EAW62697.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Alternative splice isoforms for AGTPBP1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for AGTPBP1 Gene

Selected DME Specific Peptides for AGTPBP1 Gene

Q9UPW5:
  • ICYYKNH
  • EYDLILNSDINSNHYHQWFYFEV
  • ARVHPGE
  • SPTTYVL
  • MYSVQEA
  • EEVDYSAESND
  • KFGVKAR
  • VRTLDPLVNTSSLIMRKCFPKNRLPLPTIKS
  • PMLNPDGV
  • HKDDVCYFAYHYPYTYS
  • FNIINCEK
  • YGCSIKET
  • FNSKFESGNL
  • LDTLAALLKS

Post-translational modifications for AGTPBP1 Gene

  • Ubiquitination at Lys44
  • Modification sites at PhosphoSitePlus

Domains & Families for AGTPBP1 Gene

Gene Families for AGTPBP1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted secreted proteins

Protein Domains for AGTPBP1 Gene

Suggested Antigen Peptide Sequences for AGTPBP1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ58181, highly similar to Homo sapiens ATP/GTP binding protein 1 (AGTPBP1), mRNA (B4DHX2_HUMAN)
  • Nervous system nuclear protein induced by axotomy protein 1 homolog (CBPC1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9UPW5

UniProtKB/Swiss-Prot:

CBPC1_HUMAN :
  • Belongs to the peptidase M14 family.
Family:
  • Belongs to the peptidase M14 family.
genes like me logo Genes that share domains with AGTPBP1: view

Function for AGTPBP1 Gene

Molecular function for AGTPBP1 Gene

UniProtKB/Swiss-Prot Function:
Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins (PubMed:30420557). Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5.

Enzyme Numbers (IUBMB) for AGTPBP1 Gene

Phenotypes From GWAS Catalog for AGTPBP1 Gene

Gene Ontology (GO) - Molecular Function for AGTPBP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004180 carboxypeptidase activity IEA --
GO:0004181 metallocarboxypeptidase activity ISS,IEA --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0008270 zinc ion binding IEA --
genes like me logo Genes that share ontologies with AGTPBP1: view
genes like me logo Genes that share phenotypes with AGTPBP1: view

Human Phenotype Ontology for AGTPBP1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

  • Taconic Biosciences Mouse Models for AGTPBP1

CRISPR Products

miRNA for AGTPBP1 Gene

miRTarBase miRNAs that target AGTPBP1

Clone Products

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for AGTPBP1 Gene

Localization for AGTPBP1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for AGTPBP1 Gene

Cytoplasm. Cytoplasm, cytosol. Nucleus. Mitochondrion. Note=Localizes in both the cytoplasm and nuclei of interphase and dividing cells. {ECO:0000269 PubMed:23085998}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for AGTPBP1 gene
Compartment Confidence
nucleus 5
mitochondrion 4
cytosol 4
cytoskeleton 2
extracellular 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli (2)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for AGTPBP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA,IEA 23085998
GO:0005730 nucleolus IDA --
GO:0005737 cytoplasm IDA,IEA 23085998
GO:0005739 mitochondrion ISS,IEA --
GO:0005829 cytosol IEA,ISS --
genes like me logo Genes that share ontologies with AGTPBP1: view

Pathways & Interactions for AGTPBP1 Gene

PathCards logo

SuperPathways for AGTPBP1 Gene

SuperPathway Contained pathways
1 Neuroscience
genes like me logo Genes that share pathways with AGTPBP1: view

Pathways by source for AGTPBP1 Gene

1 Cell Signaling Technology pathway for AGTPBP1 Gene

Gene Ontology (GO) - Biological Process for AGTPBP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001754 eye photoreceptor cell differentiation ISS --
GO:0006508 proteolysis IEA --
GO:0007005 mitochondrion organization ISS,IEA --
GO:0007628 adult walking behavior IEA --
GO:0021549 cerebellum development IEA --
genes like me logo Genes that share ontologies with AGTPBP1: view

No data available for SIGNOR curated interactions for AGTPBP1 Gene

Drugs & Compounds for AGTPBP1 Gene

No Compound Related Data Available

Transcripts for AGTPBP1 Gene

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for AGTPBP1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12a · 12b ^ 13a · 13b ^ 14a · 14b ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^
SP1: - - - -
SP2: - - -
SP3:
SP4: -
SP5:

ExUns: 22 ^ 23 ^ 24 ^ 25 ^ 26 ^ 27a · 27b
SP1:
SP2:
SP3:
SP4:
SP5:

Relevant External Links for AGTPBP1 Gene

GeneLoc Exon Structure for
AGTPBP1
ECgene alternative splicing isoforms for
AGTPBP1

Expression for AGTPBP1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for AGTPBP1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for AGTPBP1 Gene

This gene is overexpressed in Whole Blood (x7.4).

Protein differential expression in normal tissues from HIPED for AGTPBP1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (15.7), Monocytes (13.4), Fetal Brain (12.5), Platelet (10.0), and Retina (6.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for AGTPBP1 Gene



Protein tissue co-expression partners for AGTPBP1 Gene

NURSA nuclear receptor signaling pathways regulating expression of AGTPBP1 Gene:

AGTPBP1

SOURCE GeneReport for Unigene cluster for AGTPBP1 Gene:

Hs.719980

Evidence on tissue expression from TISSUES for AGTPBP1 Gene

  • Nervous system(4.9)
  • Lymph node(4.2)
genes like me logo Genes that share expression patterns with AGTPBP1: view

No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for AGTPBP1 Gene

Orthologs for AGTPBP1 Gene

This gene was present in the common ancestor of animals.

Orthologs for AGTPBP1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia AGTPBP1 33 32
  • 99.91 (n)
OneToOne
dog
(Canis familiaris)
Mammalia AGTPBP1 33 32
  • 92.48 (n)
OneToOne
cow
(Bos Taurus)
Mammalia AGTPBP1 33 32
  • 92.46 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Agtpbp1 17 33 32
  • 85.22 (n)
rat
(Rattus norvegicus)
Mammalia Agtpbp1 32
  • 84.9 (n)
oppossum
(Monodelphis domestica)
Mammalia AGTPBP1 33
  • 82 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia AGTPBP1 33
  • 64 (a)
OneToOne
chicken
(Gallus gallus)
Aves AGTPBP1 33 32
  • 76.45 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia AGTPBP1 33
  • 77 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia agtpbp1 32
  • 71.5 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.19750 32
zebrafish
(Danio rerio)
Actinopterygii agtpbp1 33 32
  • 65.75 (n)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea F56H1.5 34
  • 42 (a)
EEED8.6 34
  • 40 (a)
ccpp-1 33
  • 28 (a)
OneToMany
Species where no ortholog for AGTPBP1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for AGTPBP1 Gene

ENSEMBL:
Gene Tree for AGTPBP1 (if available)
TreeFam:
Gene Tree for AGTPBP1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for AGTPBP1: view image

Paralogs for AGTPBP1 Gene

Paralogs for AGTPBP1 Gene

(2) SIMAP similar genes for AGTPBP1 Gene using alignment to 4 proteins:

  • CBPC1_HUMAN
  • B4DHX2_HUMAN
  • Q5VZW3_HUMAN
  • Q5VZW6_HUMAN
genes like me logo Genes that share paralogs with AGTPBP1: view

Variants for AGTPBP1 Gene

Sequence variations from dbSNP and Humsavar for AGTPBP1 Gene

SNP ID Clin Chr 09 pos Variation AA Info Type
rs1554699491 pathogenic, AGTPBP1-related condition, NEURODEGENERATION, CHILDHOOD-ONSET, WITH CEREBELLAR ATROPHY 85,596,450(-) C/A genic_downstream_transcript_variant, splice_acceptor_variant
rs1564034077 pathogenic, NEURODEGENERATION, CHILDHOOD-ONSET, WITH CEREBELLAR ATROPHY 85,586,895(-) T/A coding_sequence_variant, genic_downstream_transcript_variant, missense_variant, non_coding_transcript_variant
rs1564035967 pathogenic, NEURODEGENERATION, CHILDHOOD-ONSET, WITH CEREBELLAR ATROPHY 85,588,449(-) G/A coding_sequence_variant, genic_downstream_transcript_variant, intron_variant, missense_variant
rs1564041582 pathogenic, NEURODEGENERATION, CHILDHOOD-ONSET, WITH CEREBELLAR ATROPHY 85,592,562(-) G/A coding_sequence_variant, genic_downstream_transcript_variant, non_coding_transcript_variant, stop_gained
rs1564046794 pathogenic, NEURODEGENERATION, CHILDHOOD-ONSET, WITH CEREBELLAR ATROPHY 85,596,423(-) G/A coding_sequence_variant, genic_downstream_transcript_variant, non_coding_transcript_variant, stop_gained

Structural Variations from Database of Genomic Variants (DGV) for AGTPBP1 Gene

Variant ID Type Subtype PubMed ID
esv2738683 CNV deletion 23290073
esv2759702 CNV loss 17122850
esv3620941 CNV loss 21293372
esv6066 CNV gain 19470904
nsv1051546 CNV gain 25217958
nsv436717 OTHER inversion 17901297
nsv476058 CNV novel sequence insertion 20440878
nsv477830 CNV novel sequence insertion 20440878
nsv524134 CNV loss 19592680
nsv525362 CNV loss 19592680
nsv614774 CNV gain 21841781
nsv6593 CNV insertion 18451855
nsv831645 CNV loss 17160897

Variation tolerance for AGTPBP1 Gene

Residual Variation Intolerance Score: 7.22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.93; 74.48% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for AGTPBP1 Gene

Human Gene Mutation Database (HGMD)
AGTPBP1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
AGTPBP1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for AGTPBP1 Gene

Disorders for AGTPBP1 Gene

MalaCards: The human disease database

(1) MalaCards diseases for AGTPBP1 Gene - From: HGMD, OMIM, ClinVar, and GeneCards

- elite association - COSMIC cancer census association via MalaCards

UniProtKB/Swiss-Prot

CBPC1_HUMAN
  • Neurodegeneration, childhood-onset, with cerebellar atrophy (CONDCA) [MIM:618276]: An autosomal recessive disorder characterized by early onset of progressive neurodegeneration affecting the central and peripheral nervous systems. Clinical features include global developmental delay, impaired intellectual development, poor or absent speech, and motor abnormalities. Brain imaging shows cerebellar atrophy. Death in childhood may occur. {ECO:0000269 PubMed:30420557}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for AGTPBP1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with AGTPBP1: view

No data available for Genatlas for AGTPBP1 Gene

Publications for AGTPBP1 Gene

  1. Functional segregation and emerging role of cilia-related cytosolic carboxypeptidases (CCPs). (PMID: 23085998) Rodríguez de la Vega Otazo M … Bautista JM (FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013) 3 4 56
  2. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 56
  3. Regenerating motor neurons express Nna1, a novel ATP/GTP-binding protein related to zinc carboxypeptidases. (PMID: 11083920) Harris A … Soares HD (Molecular and cellular neurosciences 2000) 2 3 56
  4. Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10470851) Kikuno R … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 3 4 56
  5. Insights into the ubiquitin-proteasome system of human embryonic stem cells. (PMID: 29511261) Saez I … Vilchez D (Scientific reports 2018) 3 56

Products for AGTPBP1 Gene

Sources for AGTPBP1 Gene