This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two ... See more...

Aliases for AGPAT1 Gene

Aliases for AGPAT1 Gene

  • 1-Acylglycerol-3-Phosphate O-Acyltransferase 1 2 3 4 5
  • LPAAT-Alpha 2 3 4
  • 1-Acylglycerol-3-Phosphate O-Acyltransferase 1 (Lysophosphatidic Acid Acyltransferase, Alpha) 2 3
  • 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Alpha 3 4
  • Lysophosphatidic Acid Acyltransferase Alpha 3 4
  • 1-AGP Acyltransferase 1 3 4
  • EC 2.3.1.51 4 51
  • 1-AGPAT 1 3 4
  • G15 3 4
  • 1-Acylglycerol-3-Phosphate O-Acyltransferase 1 (Acetoacetly Coenzyme A Thiolase) 3
  • Lysophosphatidic Acid Acyltransferase, Alpha 2
  • Epididymis Secretory Sperm Binding Protein 3
  • Lysophospholipid Acyltransferase 3
  • Protein G15 4
  • 1-AGPAT1 3
  • LPAATA 3
  • AGPAT1 5

External Ids for AGPAT1 Gene

Previous GeneCards Identifiers for AGPAT1 Gene

  • GC06M032163
  • GC06M031906
  • GC06M032207
  • GC06M032243
  • GC06M031890
  • GC06M032135

Summaries for AGPAT1 Gene

Entrez Gene Summary for AGPAT1 Gene

  • This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

GeneCards Summary for AGPAT1 Gene

AGPAT1 (1-Acylglycerol-3-Phosphate O-Acyltransferase 1) is a Protein Coding gene. Diseases associated with AGPAT1 include Complete Generalized Lipodystrophy and Congenital Generalized Lipodystrophy. Among its related pathways are Glycerolipid metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring acyl groups and 1-acylglycerol-3-phosphate O-acyltransferase activity. An important paralog of this gene is AGPAT2.

UniProtKB/Swiss-Prot Summary for AGPAT1 Gene

  • Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.

Gene Wiki entry for AGPAT1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for AGPAT1 Gene

Genomics for AGPAT1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for AGPAT1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH06J032175 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 613.7 +0.7 748 5.9 ZNF221 ARHGAP35 SP1 HNRNPL CREB1 GATAD2A PRDM10 REST ZNF629 TFE3 RNF5 AGPAT1 DDX39B BRD2 LY6G5B LSM2 ATF6B MSH5 TNXB MICA
GH06J032165 Promoter/Enhancer 1.5 EPDnew Ensembl ENCODE 14.5 +10.1 10132 4.2 ARHGAP35 HNRNPL CREB1 CTCF PRDM10 LEF1 IKZF1 JUND PRDM1 DDX20 EGFL8 ATF6B RNF5 AGPAT1 SKIV2L DXO MICB HLA-DQA2 HLA-C MIR6721
GH06J032118 Enhancer 1.3 Ensembl ENCODE CraniofacialAtlas 11.8 +58.9 58916 1.5 GATAD2A CTCF TFE3 NFKBIZ JUND PRDM1 ZNF143 RBFOX2 RXRB ZNF24 ENSG00000284829 lnc-TNXB-7 PPT2 PRRT1 EGFL8 AGPAT1 RNF5 SKIV2L TNXB ATF6B
GH06J032243 Enhancer 1 ENCODE CraniofacialAtlas 11 -66.6 -66599 1.4 ZNF221 CTCF IKZF1 ZNF692 JUND ZNF143 ZIC2 ZNF24 PATZ1 REST HLA-DRB1 RING1 HLA-DRB6 RNF5 AGPAT1 EGFL8 PPT2 PRRT1 HLA-DRB5 FKBPL
GH06J032075 Enhancer 0.8 Ensembl ENCODE 11.4 +101.9 101933 2.3 ZNF629 PATZ1 DPF2 ZNF600 ZBTB20 ZNF639 CEBPB ZBTB17 ZKSCAN1 WT1 TNXB ATF6B FKBPL PPT2 PRRT1 EGFL8 AGPAT1 RNF5 PSORS1C2 NONHSAG045972.2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around AGPAT1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for AGPAT1

Top Transcription factor binding sites by QIAGEN in the AGPAT1 gene promoter:
  • E2F-3a
  • E2F-4
  • E2F-5
  • E47
  • HEN1
  • STAT3

Genomic Locations for AGPAT1 Gene

Genomic Locations for AGPAT1 Gene
chr6:32,168,212-32,178,108
(GRCh38/hg38)
Size:
9,897 bases
Orientation:
Minus strand
chr6:32,135,983-32,145,888
(GRCh37/hg19)
Size:
9,906 bases
Orientation:
Minus strand

Genomic View for AGPAT1 Gene

Genes around AGPAT1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
AGPAT1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for AGPAT1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

Proteins for AGPAT1 Gene

  • Protein details for AGPAT1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q99943-PLCA_HUMAN
    Recommended name:
    1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
    Protein Accession:
    Q99943
    Secondary Accessions:
    • A2BFI5
    • Q5BL03

    Protein attributes for AGPAT1 Gene

    Size:
    283 amino acids
    Molecular mass:
    31717 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAB47493.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};

neXtProt entry for AGPAT1 Gene

Selected DME Specific Peptides for AGPAT1 Gene

Q99943:
  • VRHSMLT
  • SAKYFFKMAFYNGWILFLA
  • PIVMSSYQDFY
  • IFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHN
  • NHQSSLD
  • LAIPVCAVRGRNVENMKILRL
  • KYLYGIRVEVRGAHHFPP

Post-translational modifications for AGPAT1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for AGPAT1 Gene

Gene Families for AGPAT1 Gene

Protein Domains for AGPAT1 Gene

InterPro:
Blocks:
  • Phospholipid/glycerol acyltransferase
ProtoNet:

Suggested Antigen Peptide Sequences for AGPAT1 Gene

GenScript: Design optimal peptide antigens:
  • Protein G15 (PLCA_HUMAN)
  • cDNA, FLJ78849, highly similar to 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (EC 2.3.1.51) (Q9HBM8_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q99943

UniProtKB/Swiss-Prot:

PLCA_HUMAN :
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Domain:
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Family:
  • Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
genes like me logo Genes that share domains with AGPAT1: view

Function for AGPAT1 Gene

Molecular function for AGPAT1 Gene

UniProtKB/Swiss-Prot Function:
Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:19709, ChEBI:CHEBI:57287, ChEBI:CHEBI:57970, ChEBI:CHEBI:58342, ChEBI:CHEBI:58608; EC=2.3.1.51; Evidence={ECO:0000269|PubMed:21873652, ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37131, ChEBI:CHEBI:57287, ChEBI:CHEBI:57387, ChEBI:CHEBI:74544, ChEBI:CHEBI:74546; Evidence={ECO:0000269|PubMed:21873652, ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + hexadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-hexadecanoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37143, ChEBI:CHEBI:57287, ChEBI:CHEBI:57379, ChEBI:CHEBI:74544, ChEBI:CHEBI:74551; Evidence={ECO:0000269|PubMed:21873652, ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + heptadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-heptadecanoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37155, ChEBI:CHEBI:57287, ChEBI:CHEBI:74307, ChEBI:CHEBI:74544, ChEBI:CHEBI:74558; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + octadecanoyl-CoA = 1-(9Z-octadecenoyl)-2-octadecanoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37147, ChEBI:CHEBI:57287, ChEBI:CHEBI:57394, ChEBI:CHEBI:74544, ChEBI:CHEBI:74552; Evidence={ECO:0000269|PubMed:21873652, ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z,12Z)-octadecadienoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37159, ChEBI:CHEBI:57287, ChEBI:CHEBI:57383, ChEBI:CHEBI:74544, ChEBI:CHEBI:74563; Evidence={ECO:0000269|PubMed:21873652, ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + tetradecanoyl-CoA = 1-(9Z)-octadecenoyl-2-tetradecanoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37171, ChEBI:CHEBI:57287, ChEBI:CHEBI:57385, ChEBI:CHEBI:74544, ChEBI:CHEBI:74579; Evidence={ECO:0000269|PubMed:21873652, ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + pentadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-pentadecanoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37175, ChEBI:CHEBI:57287, ChEBI:CHEBI:74309, ChEBI:CHEBI:74544, ChEBI:CHEBI:74578; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoyl-CoA + 1-hexadecanoyl-sn-glycero-3-phosphate = 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:33187, ChEBI:CHEBI:57287, ChEBI:CHEBI:57387, ChEBI:CHEBI:57518, ChEBI:CHEBI:64839; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoyl-CoA + 1-(9Z,12Z,15Z)-octadecatrienoyl-sn-glycero-3-phosphate = 1-(9Z,12Z,15Z)-octadecatrienoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37139, ChEBI:CHEBI:57287, ChEBI:CHEBI:57387, ChEBI:CHEBI:74549, ChEBI:CHEBI:74550; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoyl-CoA + 1-(6Z,9Z,12Z-octadecatrienoyl)-sn-glycero-3-phosphate = (6Z,9Z,12Z)-octadecatrienoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37179, ChEBI:CHEBI:57287, ChEBI:CHEBI:57387, ChEBI:CHEBI:74581, ChEBI:CHEBI:74582; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoyl-CoA + 1-eicosanoyl-sn-glycero-3-phosphate = 1-eicosanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37183, ChEBI:CHEBI:57287, ChEBI:CHEBI:57387, ChEBI:CHEBI:74583, ChEBI:CHEBI:74584; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoyl-CoA + 1-tetradecanoyl-sn-glycerol 3-phosphate = 1-tetradecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37187, ChEBI:CHEBI:57287, ChEBI:CHEBI:57387, ChEBI:CHEBI:72683, ChEBI:CHEBI:74586; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37443, ChEBI:CHEBI:57287, ChEBI:CHEBI:57368, ChEBI:CHEBI:74544, ChEBI:CHEBI:74928; Evidence={ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + dodecanoyl-CoA = 1-(9Z)-octadecenoyl-2-dodecanoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37591, ChEBI:CHEBI:57287, ChEBI:CHEBI:57375, ChEBI:CHEBI:74544, ChEBI:CHEBI:75076; Evidence={ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(6Z)-octadecenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-(6Z)-octadecenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37607, ChEBI:CHEBI:57287, ChEBI:CHEBI:74544, ChEBI:CHEBI:75123, ChEBI:CHEBI:75124; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(11Z)-octadecenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-(11Z)-octadecenoyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:37603, ChEBI:CHEBI:57287, ChEBI:CHEBI:74544, ChEBI:CHEBI:75121, ChEBI:CHEBI:75122; Evidence={ECO:0000269|PubMed:21873652};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-hexadecenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z-octadecenoyl)-2-(9Z-hexadecenoyl)-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:40195, ChEBI:CHEBI:57287, ChEBI:CHEBI:61540, ChEBI:CHEBI:74544, ChEBI:CHEBI:74697; Evidence={ECO:0000269|PubMed:9461603};.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=137.97 uM for C14:0-CoA {ECO:0000269|PubMed:21873652}; KM=3.04 uM for C15:0-CoA {ECO:0000269|PubMed:21873652}; KM=116.73 uM for C18:0-CoA {ECO:0000269|PubMed:21873652}; KM=39.37 uM for C18:1-CoA {ECO:0000269|PubMed:21873652}; KM=6.0 uM for LPA sn-1 C18:1 {ECO:0000269|PubMed:21873652}; Vmax=96.21 nmol/min/mg enzyme for C14:0-CoA {ECO:0000269|PubMed:21873652}; Vmax=86.09 nmol/min/mg enzyme for C15:0-CoA {ECO:0000269|PubMed:21873652}; Vmax=91.94 nmol/min/mg enzyme for C18:0-CoA {ECO:0000269|PubMed:21873652}; Vmax=77.57 nmol/min/mg enzyme for C18:1-CoA {ECO:0000269|PubMed:21873652}; Vmax=92.0 nmol/min/mg enzyme for LPA sn-1 C18:1 {ECO:0000269|PubMed:21873652};
GENATLAS Biochemistry:
lysophosphatidic acid acyltransferase alpha,expressed in many tissues with highest expression in skeletal muscle,localized in endoplasmic reticulum

Enzyme Numbers (IUBMB) for AGPAT1 Gene

Phenotypes From GWAS Catalog for AGPAT1 Gene

Gene Ontology (GO) - Molecular Function for AGPAT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003841 1-acylglycerol-3-phosphate O-acyltransferase activity IGI 9212163
GO:0005515 protein binding IPI 25416956
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
genes like me logo Genes that share ontologies with AGPAT1: view
genes like me logo Genes that share phenotypes with AGPAT1: view

Animal Models for AGPAT1 Gene

MGI Knock Outs for AGPAT1:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for AGPAT1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for AGPAT1 Gene

Localization for AGPAT1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for AGPAT1 Gene

Endoplasmic reticulum membrane. Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for AGPAT1 gene
Compartment Confidence
endoplasmic reticulum 5
plasma membrane 2
extracellular 2
mitochondrion 2
cytoskeleton 1
peroxisome 1
nucleus 1
endosome 1
cytosol 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Endoplasmic reticulum (3)
  • Rods & Rings (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for AGPAT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum TAS,IDA 9461603
GO:0005789 endoplasmic reticulum membrane TAS --
GO:0016020 membrane HDA 19946888
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with AGPAT1: view

Pathways & Interactions for AGPAT1 Gene

genes like me logo Genes that share pathways with AGPAT1: view

UniProtKB/Swiss-Prot Q99943-PLCA_HUMAN

  • Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.

Gene Ontology (GO) - Biological Process for AGPAT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001819 positive regulation of cytokine production IMP 9212163
GO:0001961 positive regulation of cytokine-mediated signaling pathway IC 9212163
GO:0006629 lipid metabolic process IEA --
GO:0006644 phospholipid metabolic process TAS 9212163
GO:0006654 phosphatidic acid biosynthetic process IGI,TAS --
genes like me logo Genes that share ontologies with AGPAT1: view

No data available for SIGNOR curated interactions for AGPAT1 Gene

Drugs & Compounds for AGPAT1 Gene

(4) Drugs for AGPAT1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Hexanoyl-CoA Experimental Pharma 0
Propanoyl-CoA Experimental Pharma 0
Coenzyme A Investigational Nutra 0

(57) Additional Compounds for AGPAT1 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
(2E)-Decenoyl-CoA
  • (e)-S-2-Decenoate
  • (e)-S-2-Decenoate CoA
  • (e)-S-2-Decenoate coenzyme A
  • (e)-S-2-Decenoic acid
  • 2-trans-Decenoyl-CoA
10018-95-8
(2E)-Dodecenoyl-CoA
1066-12-2
(2E)-Hexadecenoyl-CoA
  • (e)-C16:1 N-14-CoA
  • (e)-Hexadec-2-enoyl-CoA tetraanion
  • (e)-Hexadec-2-enoyl-coenzyme A tetraanion
  • (e)-Hexadec-2-enoyl-coenzyme A(4-)
  • trans-2-Hexadecenoyl-CoA(4-)
4460-95-1
(2E)-Octenoyl-CoA
  • (e)-S-2-Octenoate
  • (e)-S-2-Octenoate CoA
  • (e)-S-2-Octenoate coenzyme A
  • (e)-S-2-Octenoic acid
  • 2,3-trans-Octenoyl coenzyme A
10018-94-7
(2E)-Tetradecenoyl-CoA
  • (2E)-Tetradecenoyl-coenzyme A
  • trans-Tetra-dec-2-enoyl-CoA
  • trans-Tetra-dec-2-enoyl-coa.
  • trans-Tetra-dec-2-enoyl-coenzyme A
  • trans-Tetra-dec-2-enoyl-coenzyme A.
38795-33-4
genes like me logo Genes that share compounds with AGPAT1: view

Transcripts for AGPAT1 Gene

mRNA/cDNA for AGPAT1 Gene

5 REFSEQ mRNAs :
20 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for AGPAT1

Alternative Splicing Database (ASD) splice patterns (SP) for AGPAT1 Gene

No ASD Table

Relevant External Links for AGPAT1 Gene

GeneLoc Exon Structure for
AGPAT1

Expression for AGPAT1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for AGPAT1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

  • Testis (Reproductive System)

Protein differential expression in normal tissues from HIPED for AGPAT1 Gene

This gene is overexpressed in Bone (40.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for AGPAT1 Gene



Protein tissue co-expression partners for AGPAT1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for AGPAT1

SOURCE GeneReport for Unigene cluster for AGPAT1 Gene:

Hs.409230

mRNA Expression by UniProt/SwissProt for AGPAT1 Gene:

Q99943-PLCA_HUMAN
Tissue specificity: Widely expressed. Expressed in adipose tissue and at high levels in testis and pancreas. Expressed at lower levels in tissues such as heart, brain, placenta, kidney, lung, spleen, thymus, prostate, ovary, intestine, colon, leukocyte and liver.

Evidence on tissue expression from TISSUES for AGPAT1 Gene

  • Nervous system(4.9)
  • Skin(4.7)
  • Lung(4.4)
  • Muscle(2.8)
  • Intestine(2.7)
  • Liver(2.5)
  • Eye(2.4)
  • Blood(2.3)
  • Kidney(2.3)
  • Heart(2.1)
genes like me logo Genes that share expression patterns with AGPAT1: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for AGPAT1 Gene

Orthologs for AGPAT1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for AGPAT1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia AGPAT1 30 31
  • 99.88 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia AGPAT1 30 31
  • 93.4 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia AGPAT1 30 31
  • 93.4 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia AGPAT1 31
  • 92 (a)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Agpat1 30
  • 89.64 (n)
Mouse
(Mus musculus)
Mammalia Agpat1 30 17 31
  • 89.17 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia AGPAT1 31
  • 71 (a)
OneToOne
Chicken
(Gallus gallus)
Aves -- 31
  • 53 (a)
ManyToMany
-- 31
  • 47 (a)
ManyToMany
Lizard
(Anolis carolinensis)
Reptilia AGPAT1 31
  • 61 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia agpat1 30
  • 65.75 (n)
Str.17787 30
African clawed frog
(Xenopus laevis)
Amphibia Xl.15198 30
Zebrafish
(Danio rerio)
Actinopterygii agpat2 30
  • 58.06 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP002021 30
  • 51.22 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta CG3812 30 31 32
  • 50 (n)
ManyToMany
fu12 31 32
  • 30 (a)
ManyToMany
Worm
(Caenorhabditis elegans)
Secernentea acl-2 30 31
  • 48.6 (n)
ManyToMany
T06E8.1 32
  • 41 (a)
acl-1 31
  • 28 (a)
ManyToMany
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SLC1 31 33 33 33
  • 25 (a)
OneToMany
Species where no ortholog for AGPAT1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for AGPAT1 Gene

ENSEMBL:
Gene Tree for AGPAT1 (if available)
TreeFam:
Gene Tree for AGPAT1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for AGPAT1: view image

Paralogs for AGPAT1 Gene

Paralogs for AGPAT1 Gene

(1) SIMAP similar genes for AGPAT1 Gene using alignment to 2 proteins:

  • PLCA_HUMAN
  • Q9HBM8_HUMAN
genes like me logo Genes that share paralogs with AGPAT1: view

Variants for AGPAT1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for AGPAT1 Gene

SNP ID Clinical significance and condition Chr 06 pos Variation AA Info Type
rs11964847 - p.Pro30Ser

Additional dbSNP identifiers (rs#s) for AGPAT1 Gene

Structural Variations from Database of Genomic Variants (DGV) for AGPAT1 Gene

Variant ID Type Subtype PubMed ID
dgv10404n54 CNV loss 21841781
dgv10463n54 CNV loss 21841781
dgv10472n54 CNV loss 21841781
esv24778 CNV loss 19812545
esv2759415 CNV gain+loss 17122850
nsv1073969 CNV deletion 25765185
nsv1112900 CNV deletion 24896259
nsv1126749 CNV deletion 24896259
nsv602104 CNV loss 21841781
nsv830629 CNV loss 17160897

Variation tolerance for AGPAT1 Gene

Residual Variation Intolerance Score: 44% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.65; 13.99% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for AGPAT1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
AGPAT1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for AGPAT1 Gene

Disorders for AGPAT1 Gene

MalaCards: The human disease database

(4) MalaCards diseases for AGPAT1 Gene - From: DISEASES

- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for AGPAT1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with AGPAT1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for AGPAT1 Gene

Publications for AGPAT1 Gene

  1. Characterization of a human lysophosphatidic acid acyltransferase that is encoded by a gene located in the class III region of the human major histocompatibility complex. (PMID: 9461603) Aguado B … Campbell RD (The Journal of biological chemistry 1998) 2 3 4 23
  2. A human cDNA sequence with homology to non-mammalian lysophosphatidic acid acyltransferases. (PMID: 9291118) Stamps AC … Finnen MJ (The Biochemical journal 1997) 2 3 4
  3. Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells. (PMID: 9212163) West J … Leung DW (DNA and cell biology 1997) 3 4 23
  4. Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations. (PMID: 22359512) Demirkan A … EUROSPAN consortium (PLoS genetics 2012) 3 41
  5. Human 1-acylglycerol-3-phosphate O-acyltransferase isoforms 1 and 2: biochemical characterization and inability to rescue hepatic steatosis in Agpat2(-/-) gene lipodystrophic mice. (PMID: 21873652) Agarwal AK … Garg A (The Journal of biological chemistry 2011) 3 4

Products for AGPAT1 Gene

  • Signalway ELISA kits for AGPAT1
  • Signalway Proteins for AGPAT1

Sources for AGPAT1 Gene