Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by R... See more...
Aliases for AGO2 Gene
Aliases for AGO2 Gene
- Argonaute RISC Catalytic Component 2 2 3 4 5
- Cancer Susceptibility Candidate 7 (Non-Protein Coding) 2 3
- Eukaryotic Translation Initiation Factor 2C, 2 2 3
- PAZ Piwi Domain Protein 3 4
- Protein Argonaute-2 3 4
- Protein Slicer 3 4
- EIF2C2 3 4
- PPD 3 4
- Eukaryotic Translation Initiation Factor 2C 2 4
- Long Intergenic Non-Protein Coding RNA 980 3
- Argonaute 2, RISC Catalytic Component 3
External Ids for AGO2 Gene
- HGNC: 3263
- Entrez Gene: 27161
- Ensembl: ENSG00000123908
- OMIM: 606229
- UniProtKB: Q9UKV8
Previous HGNC Symbols for AGO2 Gene
- EIF2C2
- CASC7
Previous GeneCards Identifiers for AGO2 Gene
- GC08M141542
- GC08M140531
Summaries for AGO2 Gene
-
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
GeneCards Summary for AGO2 Gene
AGO2 (Argonaute RISC Catalytic Component 2) is a Protein Coding gene. Diseases associated with AGO2 include Colorectal Cancer and Eunuchism. Among its related pathways are Downstream signaling events of B Cell Receptor (BCR) and RET signaling. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is AGO1.
UniProtKB/Swiss-Prot Summary for AGO2 Gene
-
Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.
Additional gene information for AGO2 Gene
- Monarch Initiative
- Search for AGO2 at DataMed
- Search for AGO2 at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for AGO2 Gene
Genomics for AGO2 Gene
GeneHancer (GH) Regulatory Elements for AGO2 Gene
Promoters and enhancers for AGO2 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around AGO2 on UCSC Golden Path with GeneCards custom track
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for AGO2
Genomic Locations for AGO2 Gene
Genomic Locations for AGO2 Gene
- chr8:140,520,156-140,642,326
- (GRCh38/hg38)
- Size:
- 122,171 bases
- Orientation:
- Minus strand
- chr8:141,541,264-141,645,718
- (GRCh37/hg19)
- Size:
- 104,455 bases
- Orientation:
- Minus strand
Genomic View for AGO2 Gene
Genes around AGO2 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 8q24.3 by HGNC
- 8q24.3 by Entrez Gene
- 8q24.3 by Ensembl
AGO2 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for AGO2 Gene
Proteins for AGO2 Gene
-
Protein details for AGO2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9UKV8-AGO2_HUMAN
- Recommended name:
- Protein argonaute-2
- Protein Accession:
- Q9UKV8
- Q8TCZ5
- Q8WV58
- Q96ID1
Protein attributes for AGO2 Gene
- Size:
- 859 amino acids
- Molecular mass:
- 97208 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Interacts with DICER1 through its Piwi domain and with TARBP2 during assembly of the RNA-induced silencing complex (RISC). Together, DICER1, AGO2 and TARBP2 constitute the trimeric RISC loading complex (RLC), or micro-RNA (miRNA) loading complex (miRLC). Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. Note however that the term RISC has also been used to describe the trimeric RLC/miRLC. The formation of RISC complexes containing siRNAs rather than miRNAs appears to occur independently of DICER1. Interacts with AGO1. Also interacts with DDB1, DDX5, DDX6, DDX20, DHX30, DHX36, DDX47, DHX9, ELAVL, FXR1, GEMIN4, HNRNPF, IGF2BP1, ILF3, IMP8, MATR3, PABPC1, PRMT5, P4HA1, P4HB, RBM4, SART3, TNRC6A, TNRC6B, UPF1 and YBX1. Interacts with the P-body components DCP1A and XRN1. Associates with polysomes and messenger ribonucleoproteins (mNRPs). Interacts with RBM4; the interaction is modulated under stress-induced conditions, occurs under both cell proliferation and differentiation conditions and in an RNA- and phosphorylation-independent manner. Interacts with LIMD1, WTIP and AJUBA. Interacts with TRIM71; the interaction increases in presence of RNA (PubMed:23125361). Interacts with APOBEC3G in an RNA-dependent manner. Interacts with APOBEC3A, APOBEC3C, APOBEC3F and APOBEC3H. Interacts with DICER1, TARBP2, EIF6, MOV10 and RPL7A (60S ribosome subunit); they form a large RNA-induced silencing complex (RISC) (PubMed:17507929, PubMed:24726324). Interacts with FMR1 (PubMed:14703574). Interacts with ZFP36 (PubMed:15766526). Found in a complex, composed of AGO2, CHD7 and FAM172A (By similarity). Interacts with RC3H1; the interaction is RNA independent (PubMed:25697406). Interacts with SND1 (PubMed:14508492, PubMed:28546213). Interacts with SYT11 (By similarity). Interacts with CLNK (PubMed:26009488).
- SequenceCaution:
-
- Sequence=AAH07633.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; Sequence=AAL76093.1; Type=Miscellaneous discrepancy; Note=cDNA contains a duplication of an internal sequence at the 5' end.; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for AGO2 Gene
Protein Expression for AGO2 Gene
Selected DME Specific Peptides for AGO2 Gene
- Q9UKV8:
-
- NERVGKSGNIPAGTTVDTKITHP
- QIFGDRKPVFDGRKNLYTAMPLPI
- GRTIKLQANFFEMDIPKIDIYHYELDIKPEK
- EFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQIL
- QALDVVMRHLPSMRYTPVGRSFFTASEGC
- MTDVTGRVLQPPSILYGGR
- KAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQC
- CVSLQALHDALSGRLP
- CEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHC
- NPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKA
Post-translational modifications for AGO2 Gene
- Hydroxylated. 4-hydroxylation appears to enhance protein stability but is not required for miRNA-binding or endonuclease activity.
-
Ubiquitination at Lys550
- NX_Q9UKV8 (NX_Q9UKV8-1)
- Modification sites at PhosphoSitePlus
Other Protein References for AGO2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ AGO2 Antibody
- Creative Diagnostics Anti-AGO2 (full length) polyclonal antibody
-
Custom Antibody ServicesOriGene Antibodies for AGO2
- Novus Biologicals Antibodies for AGO2
-
Abcam antibodies for AGO2
- Invitrogen Antibodies for AGO2 (AFLGC-AGO2)
- antibodies-online: Show 15 available AGO2 Antibodies ranked by validation data
- Compare Top AGO2 Antibodies
-
Recommended
-
Santa Cruz Biotechnology (SCBT) Antibodies for AGO2
- Sino Biological Antibodies for AGO2
Protein Products
-
OriGene Purified Proteins for AGO2
- Search Origene for MassSpec and Protein Over-expression Lysates for AGO2
- Origene Custom Protein Services for AGO2
- Sino Biological Recombinant Proteins for AGO2
- Sino Biological Cell Lysates for AGO2
- ProSpec Recombinant Proteins for AGO2
-
Abcam proteins for AGO2
Assay Products
- G Biosciences Immunotag™ Protein argonaute-2 ELISA Kit
- Aviva Systems Biology EIF2C2 ELISA Kit (Human) : 96 Wells (OKEH02165)
Domains & Families for AGO2 Gene
Gene Families for AGO2 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for AGO2 Gene
- Blocks:
-
- Argonaute and Dicer protein, PAZ
- Stem cell self-renewal protein Piwi
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for AGO2 Gene
- GenScript: Design optimal peptide antigens:
-
- EIF2C2 protein (A4FVC0_HUMAN)
- Protein slicer (AGO2_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9UKV8UniProtKB/Swiss-Prot:
AGO2_HUMAN :- The Piwi domain may perform RNA cleavage by a mechanism similar to that of RNase H. However, while RNase H utilizes a triad of Asp-Asp-Glu (DDE) for metal ion coordination, this protein appears to utilize a triad of Asp-Asp-His (DDH).
- Belongs to the argonaute family. Ago subfamily.
- Domain:
-
- The Piwi domain may perform RNA cleavage by a mechanism similar to that of RNase H. However, while RNase H utilizes a triad of Asp-Asp-Glu (DDE) for metal ion coordination, this protein appears to utilize a triad of Asp-Asp-His (DDH).
- Family:
-
- Belongs to the argonaute family. Ago subfamily.
Function for AGO2 Gene
Molecular function for AGO2 Gene
- UniProtKB/Swiss-Prot Function:
- Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=Endonucleolytic cleavage to 5'-phosphomonoester.; EC=3.1.26.n2; Evidence={ECO:0000255 HAMAP-Rule:MF_03031, ECO:0000269 PubMed:15105377, ECO:0000269 PubMed:23746446};.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by EDTA.
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=1.1 nM for a synthetic 21-nucleotide single-stranded RNA {ECO:0000269 PubMed:15105377, ECO:0000269 PubMed:15800637};
Enzyme Numbers (IUBMB) for AGO2 Gene
Phenotypes From GWAS Catalog for AGO2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000340 | RNA 7-methylguanosine cap binding | IDA | 17524464 |
| GO:0000993 | RNA polymerase II complex binding | IDA | 25336585 |
| GO:0001047 | core promoter binding | IMP | 25336585 |
| GO:0003676 | nucleic acid binding | IEA | -- |
| GO:0003723 | RNA binding | HDA,IEA | 22658674 |
Phenotypes for AGO2 Gene
- MGI mutant phenotypes for AGO2:
-
inferred from 6 alleles
- cardiovascular system phenotype
- homeostasis/metabolism phenotype
- nervous system phenotype
- no phenotypic analysis
- integument phenotype
- endocrine/exocrine gland phenotype
- mortality/aging
- cellular phenotype
- embryo phenotype
- normal phenotype
- hematopoietic system phenotype
- immune system phenotype
- growth/size/body region phenotype
- GenomeRNAi human phenotypes for AGO2:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for AGO2 - Select products 50% OFF >
- * AGO2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * AGO2 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
OriGene CRISPR knockouts for AGO2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for AGO2
- genomics-online: gRNA clones - Search for available AGO2 gRNA products
- Overview of 152 available AGO2 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for AGO2
miRNA for AGO2 Gene
- miRTarBase miRNAs that target AGO2
-
- hsa-mir-376a-3p (MIRT007020)
- hsa-mir-215-5p (MIRT024741)
- hsa-mir-192-5p (MIRT026680)
- hsa-mir-107 (MIRT026970)
- hsa-mir-99a-5p (MIRT027394)
- hsa-mir-21-5p (MIRT031016)
- hsa-mir-16-5p (MIRT031917)
- hsa-mir-671-5p (MIRT039278)
- hsa-mir-652-3p (MIRT039512)
- hsa-mir-186-5p (MIRT045258)
- hsa-mir-30d-5p (MIRT047789)
- hsa-mir-30a-5p (MIRT049935)
- hsa-let-7e-5p (MIRT051431)
- hsa-let-7b-5p (MIRT052006)
- hsa-let-7a-5p (MIRT052575)
- hsa-mir-3120-3p (MIRT224538)
- hsa-mir-3133 (MIRT363351)
- hsa-mir-184 (MIRT437895)
- hsa-mir-4795-3p (MIRT482264)
- hsa-mir-223-5p (MIRT482266)
- hsa-mir-5193 (MIRT482267)
- hsa-mir-3934-5p (MIRT482268)
- hsa-mir-764 (MIRT482269)
- hsa-mir-5002-5p (MIRT482270)
- hsa-mir-125a-3p (MIRT482271)
- hsa-mir-126-5p (MIRT482272)
- hsa-mir-548l (MIRT482273)
- hsa-mir-559 (MIRT482274)
- hsa-mir-548y (MIRT482275)
- hsa-mir-548o-5p (MIRT482276)
- hsa-mir-548w (MIRT482277)
- hsa-mir-548j-5p (MIRT482278)
- hsa-mir-548i (MIRT482279)
- hsa-mir-548h-5p (MIRT482280)
- hsa-mir-548d-5p (MIRT482281)
- hsa-mir-548bb-5p (MIRT482282)
- hsa-mir-548c-5p (MIRT482283)
- hsa-mir-548b-5p (MIRT482284)
- hsa-mir-548ay-5p (MIRT482285)
- hsa-mir-548au-5p (MIRT482286)
- hsa-mir-548as-5p (MIRT482287)
- hsa-mir-548ar-5p (MIRT482288)
- hsa-mir-548ap-5p (MIRT482289)
- hsa-mir-548aq-5p (MIRT482290)
- hsa-mir-548am-5p (MIRT482291)
- hsa-mir-548ak (MIRT482292)
- hsa-mir-548ae-5p (MIRT482293)
- hsa-mir-548ad-5p (MIRT482294)
- hsa-mir-548ab (MIRT482295)
- hsa-mir-6887-5p (MIRT482296)
- hsa-mir-548a-5p (MIRT482297)
- hsa-mir-6795-5p (MIRT482298)
- hsa-mir-7111-5p (MIRT482299)
- hsa-mir-6870-5p (MIRT482300)
- hsa-mir-5698 (MIRT482301)
- hsa-mir-8085 (MIRT482302)
- hsa-mir-4723-5p (MIRT482303)
- hsa-mir-6731-5p (MIRT482304)
- hsa-mir-4644 (MIRT482305)
- hsa-mir-4306 (MIRT482306)
- hsa-mir-185-5p (MIRT482307)
- hsa-mir-6133 (MIRT482308)
- hsa-mir-6129 (MIRT482309)
- hsa-mir-6130 (MIRT482310)
- hsa-mir-6127 (MIRT482311)
- hsa-mir-4510 (MIRT482312)
- hsa-mir-4419a (MIRT482313)
- hsa-mir-4524a-3p (MIRT482314)
- hsa-mir-6794-5p (MIRT482315)
- hsa-mir-4716-3p (MIRT482316)
- hsa-mir-4739 (MIRT482317)
- hsa-mir-4756-5p (MIRT482318)
- hsa-mir-1321 (MIRT482319)
- hsa-mir-6873-5p (MIRT482320)
- hsa-mir-4507 (MIRT482321)
- hsa-mir-3940-5p (MIRT482322)
- hsa-mir-6751-5p (MIRT482323)
- hsa-mir-6803-5p (MIRT482324)
- hsa-mir-7109-5p (MIRT482325)
- hsa-mir-4665-5p (MIRT482326)
- hsa-mir-6811-5p (MIRT482327)
- hsa-mir-1275 (MIRT482328)
- hsa-mir-6511b-5p (MIRT482329)
- hsa-mir-6793-5p (MIRT482330)
- hsa-mir-92a-1-5p (MIRT482331)
- hsa-mir-6769b-5p (MIRT482332)
- hsa-mir-92a-2-5p (MIRT482333)
- hsa-mir-6769a-5p (MIRT482334)
- hsa-mir-654-5p (MIRT482335)
- hsa-mir-541-3p (MIRT482336)
- hsa-mir-5010-5p (MIRT482337)
- hsa-mir-4525 (MIRT482338)
- hsa-mir-6878-5p (MIRT482339)
- hsa-mir-625-5p (MIRT482340)
- hsa-mir-1193 (MIRT482341)
- hsa-mir-4722-5p (MIRT482342)
- hsa-mir-1286 (MIRT482343)
- hsa-mir-6841-3p (MIRT482344)
- hsa-mir-873-5p (MIRT482345)
- hsa-mir-6895-5p (MIRT482346)
- hsa-mir-583 (MIRT482347)
- hsa-mir-6825-5p (MIRT482348)
- hsa-mir-3144-5p (MIRT482349)
- hsa-mir-6781-5p (MIRT482350)
- hsa-mir-6883-5p (MIRT482351)
- hsa-mir-6785-5p (MIRT482352)
- hsa-mir-4728-5p (MIRT482353)
- hsa-mir-149-3p (MIRT482354)
- hsa-mir-3649 (MIRT482355)
- hsa-mir-6797-5p (MIRT482356)
- hsa-mir-6077 (MIRT482357)
- hsa-mir-1249-5p (MIRT482358)
- hsa-mir-6836-5p (MIRT482359)
- hsa-mir-6132 (MIRT482360)
- hsa-mir-6889-5p (MIRT482361)
- hsa-mir-6777-5p (MIRT482362)
- hsa-mir-3918 (MIRT482363)
- hsa-mir-761 (MIRT482364)
- hsa-mir-3619-5p (MIRT482365)
- hsa-mir-214-3p (MIRT482366)
- hsa-mir-6822-5p (MIRT482367)
- hsa-mir-6750-5p (MIRT482368)
- hsa-mir-6165 (MIRT482369)
- hsa-mir-15a-5p (MIRT482370)
- hsa-mir-15b-5p (MIRT482371)
- hsa-mir-195-5p (MIRT482372)
- hsa-mir-424-5p (MIRT482373)
- hsa-mir-497-5p (MIRT482374)
- hsa-mir-6838-5p (MIRT482376)
- hsa-mir-3175 (MIRT485882)
- hsa-mir-6856-5p (MIRT485883)
- hsa-mir-6758-5p (MIRT485884)
- hsa-mir-8055 (MIRT503164)
- hsa-mir-8081 (MIRT503165)
- hsa-mir-627-5p (MIRT503166)
- hsa-mir-937-5p (MIRT503167)
- hsa-mir-4785 (MIRT503168)
- hsa-mir-6755-3p (MIRT503169)
- hsa-mir-3613-3p (MIRT503170)
- hsa-mir-5094 (MIRT503171)
- hsa-mir-944 (MIRT503172)
- hsa-mir-548c-3p (MIRT503173)
- hsa-mir-148b-3p (MIRT503174)
- hsa-mir-152-3p (MIRT503175)
- hsa-mir-148a-3p (MIRT503176)
- hsa-mir-374b-3p (MIRT503177)
- hsa-mir-4766-3p (MIRT503178)
- hsa-mir-6792-5p (MIRT503179)
- hsa-mir-4522 (MIRT503180)
- hsa-mir-646 (MIRT503181)
- hsa-mir-548p (MIRT503182)
- hsa-mir-3664-5p (MIRT503183)
- hsa-mir-590-5p (MIRT503184)
- hsa-mir-4799-5p (MIRT514048)
- hsa-mir-506-5p (MIRT514049)
- hsa-mir-6074 (MIRT514050)
- hsa-mir-892c-5p (MIRT514051)
- hsa-mir-103a-3p (MIRT514052)
- hsa-mir-491-3p (MIRT524987)
- hsa-mir-4509 (MIRT524988)
- hsa-mir-4699-3p (MIRT524989)
- hsa-mir-3680-3p (MIRT539343)
- hsa-mir-302c-5p (MIRT539344)
- hsa-mir-33b-5p (MIRT539345)
- hsa-mir-33a-5p (MIRT539346)
- hsa-mir-195-3p (MIRT539347)
- hsa-mir-16-2-3p (MIRT539348)
- hsa-mir-802 (MIRT539349)
- hsa-mir-3908 (MIRT539350)
- hsa-mir-4703-5p (MIRT539351)
- hsa-mir-3942-5p (MIRT539352)
- hsa-mir-7-2-3p (MIRT539353)
- hsa-mir-7-1-3p (MIRT539354)
- hsa-mir-3121-3p (MIRT539355)
- hsa-mir-548t-5p (MIRT539356)
- hsa-mir-548az-5p (MIRT539357)
- hsa-mir-548n (MIRT539358)
- hsa-mir-4744 (MIRT549405)
- hsa-mir-548e-5p (MIRT549406)
- hsa-mir-4666a-5p (MIRT559690)
- hsa-mir-548v (MIRT559691)
- hsa-mir-187-5p (MIRT559692)
- hsa-mir-222-3p (MIRT559693)
- hsa-mir-221-3p (MIRT559694)
- hsa-mir-95-5p (MIRT559695)
- hsa-mir-5688 (MIRT559696)
- hsa-mir-495-3p (MIRT559697)
- hsa-mir-4495 (MIRT568582)
- hsa-mir-5582-5p (MIRT568583)
- hsa-mir-4719 (MIRT568584)
- hsa-mir-4803 (MIRT568585)
- hsa-mir-5692a (MIRT568586)
- hsa-mir-548an (MIRT568587)
- hsa-mir-382-3p (MIRT568588)
- hsa-mir-124-3p (MIRT568589)
- hsa-mir-6763-5p (MIRT572259)
- hsa-mir-3150a-3p (MIRT572260)
- hsa-mir-6783-3p (MIRT572261)
- hsa-mir-1343-3p (MIRT572262)
- hsa-mir-939-5p (MIRT572263)
- hsa-mir-1343-5p (MIRT572264)
- hsa-mir-6827-5p (MIRT572265)
- hsa-mir-505-5p (MIRT572266)
- hsa-mir-8089 (MIRT572267)
- hsa-mir-4700-5p (MIRT572268)
- hsa-mir-4667-5p (MIRT572269)
- hsa-mir-6852-5p (MIRT572270)
- hsa-mir-6742-3p (MIRT572271)
- hsa-mir-939-3p (MIRT572272)
- hsa-mir-8064 (MIRT613332)
- hsa-mir-1911-5p (MIRT613333)
- hsa-mir-4682 (MIRT613334)
- hsa-mir-4653-5p (MIRT613335)
- hsa-mir-3921 (MIRT613336)
- hsa-mir-6777-3p (MIRT613337)
- hsa-mir-4714-5p (MIRT613338)
- hsa-mir-362-3p (MIRT613339)
- hsa-mir-329-3p (MIRT613340)
- hsa-mir-8485 (MIRT613341)
- hsa-mir-513b-5p (MIRT636724)
- hsa-mir-6837-3p (MIRT636725)
- hsa-mir-6754-3p (MIRT636726)
- hsa-mir-412-3p (MIRT636727)
- hsa-mir-145-3p (MIRT660842)
- hsa-mir-466 (MIRT660843)
- hsa-mir-4643 (MIRT660844)
- hsa-mir-576-5p (MIRT683216)
- hsa-mir-4263 (MIRT683217)
- hsa-mir-211-5p (MIRT683218)
- hsa-mir-204-5p (MIRT683219)
- hsa-mir-524-5p (MIRT683220)
- hsa-mir-520d-5p (MIRT683221)
- hsa-mir-31-3p (MIRT683222)
- hsa-mir-6832-3p (MIRT683223)
- hsa-mir-4328 (MIRT683224)
- hsa-mir-8054 (MIRT683225)
- hsa-mir-548k (MIRT683226)
- hsa-mir-548av-5p (MIRT683227)
- hsa-mir-578 (MIRT708212)
- hsa-mir-132-3p (MIRT734062)
- hsa-mir-1207-5p (MIRT736003)
- hsa-mir-1255a (MIRT736566)
- hsa-mir-1255b-5p (MIRT736589)
- hsa-mir-1298-3p (MIRT737235)
- hsa-mir-204-3p (MIRT738818)
- hsa-mir-3192-5p (MIRT741003)
- hsa-mir-3197 (MIRT741095)
- hsa-mir-3616-3p (MIRT741659)
- hsa-mir-3691-3p (MIRT742517)
- hsa-mir-3910 (MIRT742832)
- hsa-mir-4270 (MIRT743547)
- hsa-mir-4314 (MIRT743974)
- hsa-mir-4441 (MIRT744514)
- hsa-mir-4646-5p (MIRT746427)
- hsa-mir-4668-3p (MIRT746809)
- hsa-mir-4763-3p (MIRT748512)
- hsa-mir-510-3p (MIRT749723)
- hsa-mir-5187-5p (MIRT749853)
- hsa-mir-542-5p (MIRT750417)
- hsa-mir-602 (MIRT751627)
- hsa-mir-605-3p (MIRT751641)
- hsa-mir-6087 (MIRT751894)
- hsa-mir-6125 (MIRT752066)
- hsa-mir-619-5p (MIRT752536)
- hsa-mir-6506-5p (MIRT752945)
- hsa-mir-658 (MIRT753508)
- hsa-mir-6754-5p (MIRT754689)
- hsa-mir-6765-5p (MIRT755069)
- hsa-mir-6804-5p (MIRT756418)
- hsa-mir-6820-5p (MIRT756876)
- hsa-mir-8063 (MIRT760047)
- hsa-mir-92b-5p (MIRT760664)
- hsa-mir-10b-3p (MIRT761153)
- hsa-mir-181b-2-3p (MIRT762971)
- hsa-mir-181b-3p (MIRT762974)
- hsa-mir-2115-5p (MIRT763810)
- hsa-mir-2277-3p (MIRT763981)
- hsa-mir-34c-3p (MIRT765818)
- hsa-mir-3619-3p (MIRT766101)
- hsa-mir-3620-3p (MIRT766108)
- hsa-mir-3660 (MIRT766450)
- hsa-mir-3690 (MIRT767113)
- hsa-mir-4256 (MIRT768095)
- hsa-mir-4308 (MIRT768532)
- hsa-mir-4420 (MIRT768827)
- hsa-mir-4526 (MIRT770052)
- hsa-mir-4690-3p (MIRT771074)
- hsa-mir-4755-5p (MIRT771952)
- hsa-mir-4776-5p (MIRT772229)
- hsa-mir-5006-3p (MIRT772938)
- hsa-mir-504-5p (MIRT773087)
- hsa-mir-516a-3p (MIRT773451)
- hsa-mir-516b-3p (MIRT773456)
- hsa-mir-520a-3p (MIRT773748)
- hsa-mir-5685 (MIRT774960)
- hsa-mir-623 (MIRT776083)
- hsa-mir-6719-3p (MIRT777710)
- hsa-mir-6730-3p (MIRT777967)
- hsa-mir-6856-3p (MIRT780479)
- hsa-mir-7162-5p (MIRT781692)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for AGO2
- Browse OriGene Inhibitory RNA Products For AGO2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for AGO2
- genomics-online: shRNA clones - Search for available AGO2 shRNA products
- Overview of 152 available AGO2 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for AGO2 - Select products 50% OFF >
- * AGO2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * AGO2 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
-
- RC218078
- RC228592
- RG218078
- RG228592
- MR227026
- MG227026
- RR210245
- RC218078L1
- RC218078L1V
- RC218078L2
- RC218078L2V
- RC218078L3
- RC218078L3V
- RC218078L4
- RC218078L4V
- RC228592L1
- RC228592L1V
- RC228592L2
- RC228592L2V
- RC228592L3
- RC228592L3V
- RC228592L4
- RC228592L4V
- MR227026L3
- MR227026L3V
- MR227026L4
- MR227026L4V
- RR210245L3
- RR210245L3V
- RR210245L4
- RR210245L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for AGO2
- Addgene plasmids for AGO2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for AGO2
- genomics-online: cdna clones - Search for available AGO2 CDNA products
- Overview of 152 available AGO2 gene related products
- orf clones - Search for available AGO2 ORF products
- Overview of 152 available AGO2 gene related products
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for AGO2 Gene
Localization for AGO2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for AGO2 Gene
- Cytoplasm, P-body. Nucleus. Note=Translational repression of mRNAs results in their recruitment to P-bodies. Translocation to the nucleus requires IMP8.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| nucleus | 5 |
| cytosol | 4 |
| plasma membrane | 2 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| lysosome | 2 |
| peroxisome | 1 |
| golgi apparatus | 1 |
- Nucleoplasm (3)
- Cell Junctions (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000932 | P-body | IDA,IEA | 20616046 |
| GO:0005634 | nucleus | IDA,IEA | 23985560 |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005737 | cytoplasm | IEA,IDA | 15260970 |
| GO:0005829 | cytosol | TAS | -- |
Pathways & Interactions for AGO2 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | RET signaling |
.92
|
|
| 2 | GAB1 signalosome |
.89
|
|
| 3 | CDK-mediated phosphorylation and removal of Cdc6 |
.41
|
|
| 4 | Mitotic Prophase | ||
| 5 | Pre-NOTCH Expression and Processing | ||
Pathways by source for AGO2 Gene
36 Reactome pathways for AGO2 Gene
3 Qiagen pathways for AGO2 Gene
- eIF2 Pathway
- GSK3 Signaling
- RNAi Pathway
1 Cell Signaling Technology pathway for AGO2 Gene
Interacting Proteins for AGO2 Gene
Selected Interacting proteins:
Q9UKV8-AGO2_HUMAN
ENSP00000220592
for AGO2 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for AGO2
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006355 | regulation of transcription, DNA-templated | IEA | -- |
| GO:0006412 | translation | NAS | 10534406 |
| GO:0006413 | translational initiation | IEA | -- |
| GO:0006417 | regulation of translation | IEA | -- |
| GO:0007223 | Wnt signaling pathway, calcium modulating pathway | TAS | -- |
Transcripts for AGO2 Gene
mRNA/cDNA for AGO2 Gene
- 2 REFSEQ mRNAs :
- 16 NCBI additional mRNA sequence :
- 10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000220592 14595 bps (ENST00000220592.10)
- ENST00000517293 422 bps (ENST00000517293.5)
- ENST00000518019 421 bps (ENST00000518019.1)
- ENST00000519347 309 bps (ENST00000519347.1)
- ENST00000519980 3141 bps (ENST00000519980.5)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for AGO2 - Select products 50% OFF >
- * AGO2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * AGO2 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
OriGene CRISPR knockouts for AGO2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for AGO2
- genomics-online: gRNA clones - Search for available AGO2 gRNA products
- Overview of 152 available AGO2 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for AGO2
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for AGO2
- Browse OriGene Inhibitory RNA Products For AGO2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for AGO2
- genomics-online: shRNA clones - Search for available AGO2 shRNA products
- Overview of 152 available AGO2 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for AGO2 - Select products 50% OFF >
- * AGO2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * AGO2 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
-
- RC218078
- RC228592
- RG218078
- RG228592
- MR227026
- MG227026
- RR210245
- RC218078L1
- RC218078L1V
- RC218078L2
- RC218078L2V
- RC218078L3
- RC218078L3V
- RC218078L4
- RC218078L4V
- RC228592L1
- RC228592L1V
- RC228592L2
- RC228592L2V
- RC228592L3
- RC228592L3V
- RC228592L4
- RC228592L4V
- MR227026L3
- MR227026L3V
- MR227026L4
- MR227026L4V
- RR210245L3
- RR210245L3V
- RR210245L4
- RR210245L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for AGO2
- Addgene plasmids for AGO2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for AGO2
- genomics-online: cdna clones - Search for available AGO2 CDNA products
- Overview of 152 available AGO2 gene related products
- orf clones - Search for available AGO2 ORF products
- Overview of 152 available AGO2 gene related products
Relevant External Links for AGO2 Gene
- GeneLoc Exon Structure for
- AGO2
Expression for AGO2 Gene
mRNA differential expression in normal tissues according to GTEx for AGO2 Gene
This gene is overexpressed in Whole Blood (x7.5) and Muscle - Skeletal (x4.3).
This gene is overexpressed in Bone marrow stromal cell (10.1) and Lymph node (9.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for AGO2 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for AGO2
SOURCE GeneReport for Unigene cluster for AGO2 Gene:
Hs.743313Evidence on tissue expression from TISSUES for AGO2 Gene
- Nervous system(4.5)
- Eye(4.3)
- Bone marrow(2.5)
- Blood(2.3)
- Heart(2.1)
- Liver(2.1)
- Skin(2)
Primer Products
-
OriGene qPCR primer pairs for AGO2
- genomics-online: primer clones - Search for available AGO2 Primer products
- Overview of 152 available AGO2 gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for AGO2 Gene
Orthologs for AGO2 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | EIF2C2 31 30 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | AGO2 31 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | AGO2 31 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | AGO2 31 30 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | EIF2C2 31 30 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Ago2 17 31 30 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Ago2 30 |
|
||
| chicken (Gallus gallus) |
Aves | AGO2 31 |
|
OneToOne | |
| LOC100858102 30 |
|
||||
| lizard (Anolis carolinensis) |
Reptilia | AGO2 31 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | ago2 30 |
|
||
| Str.15011 30 |
|
||||
| zebrafish (Danio rerio) |
Actinopterygii | CU929240.1 31 |
|
OneToOne | |
| LOC570630 30 |
|
||||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP011717 30 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | AGO1 30 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | alg-1 30 |
|
||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | AGO5 30 |
|
||
| soybean (Glycine max) |
eudicotyledons | Gma.5747 30 |
|
- Species where no ortholog for AGO2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Evolution for AGO2 Gene
- ENSEMBL:
- Gene Tree for AGO2 (if available)
- TreeFam:
- Gene Tree for AGO2 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for AGO2: view image
Paralogs for AGO2 Gene
Variants for AGO2 Gene
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv1712972 | CNV | deletion | 17803354 |
| esv24351 | CNV | loss | 19812545 |
| esv2539959 | CNV | deletion | 19546169 |
| esv2737756 | CNV | deletion | 23290073 |
| esv2737758 | CNV | deletion | 23290073 |
| nsv1016282 | CNV | gain | 25217958 |
| nsv1025478 | CNV | gain | 25217958 |
| nsv1115144 | CNV | deletion | 24896259 |
| nsv1126125 | CNV | deletion | 24896259 |
| nsv1137621 | CNV | deletion | 24896259 |
| nsv1144237 | CNV | deletion | 24896259 |
| nsv465952 | CNV | loss | 19166990 |
| nsv512075 | CNV | loss | 21212237 |
| nsv526444 | CNV | gain | 19592680 |
| nsv612568 | CNV | gain | 21841781 |
| nsv612569 | CNV | loss | 21841781 |
| nsv612570 | CNV | gain | 21841781 |
| nsv6427 | CNV | insertion | 18451855 |
| nsv824748 | CNV | gain | 20364138 |
Residual Variation Intolerance Score:
2.86% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.13;
2.90% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for AGO2 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for AGO2 Gene
Disorders for AGO2 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| colorectal cancer |
|
|
| eunuchism |
|
|
| patau syndrome |
|
|
| gum cancer |
|
|
| chromosome 18p deletion syndrome |
|
|
Search AGO2 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for AGO2
No data available for UniProtKB/Swiss-Prot and Genatlas for AGO2 Gene
Publications for AGO2 Gene
- In vitro reconstitution of the human RISC-loading complex. (PMID: 18178619) MacRae IJ … Doudna JA (Proceedings of the National Academy of Sciences of the United States of America 2008) 3 4 23 54
- Translation repression in human cells by microRNA-induced gene silencing requires RCK/p54. (PMID: 16756390) Chu CY … Rana TM (PLoS biology 2006) 3 4 23 54
- A human, ATP-independent, RISC assembly machine fueled by pre-miRNA. (PMID: 16357216) Maniataki E … Mourelatos Z (Genes & development 2005) 3 4 23 54
- Characterization of the interactions between mammalian PAZ PIWI domain proteins and Dicer. (PMID: 14749716) Tahbaz N … Hobman TC (EMBO reports 2004) 3 4 23 54
- Human eukaryotic initiation factor EIF2C1 gene: cDNA sequence, genomic organization, localization to chromosomal bands 1p34-p35, and expression. (PMID: 10534406) Koesters R … Briner J (Genomics 1999) 2 3 4 54
ExternalLinks
Products for AGO2 Gene
- Custom Antibody ServicesOriGene Antibodies for AGO2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for AGO2
- Search Origene for MassSpec and Protein Over-expression Lysates for AGO2
- Origene Custom Protein Services for AGO2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for AGO2
- Browse OriGene Inhibitory RNA Products For AGO2
- OriGene qPCR primer pairs for AGO2
- OriGene CRISPR knockouts for AGO2
- RC218078
- RC228592
- RG218078
- RG228592
- MR227026
- MG227026
- RR210245
- RC218078L1
- RC218078L1V
- RC218078L2
- RC218078L2V
- RC218078L3
- RC218078L3V
- RC218078L4
- RC218078L4V
- RC228592L1
- RC228592L1V
- RC228592L2
- RC228592L2V
- RC228592L3
- RC228592L3V
- RC228592L4
- RC228592L4V
- MR227026L3
- MR227026L3V
- MR227026L4
- MR227026L4V
- RR210245L3
- RR210245L3V
- RR210245L4
- RR210245L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For AGO2
- Sino Biological Human cDNA Clone for AGO2
- Sino Biological Recombinant Proteins for AGO2
- Sino Biological Cell Lysates for AGO2
- Sino Biological Antibodies for AGO2
- Browse Sino Biological Assays
- Browse Recombinant Proteins
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for AGO2
- Novus Biologicals proteins and lysates for AGO2
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for AGO2
- Abcam proteins for AGO2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Addgene plasmids for AGO2
- antibodies-online: Show 15 available AGO2 Antibodies ranked by validation data
- Compare Top AGO2 Antibodies
- Recommended
- antibodies-online: Show 11 available AGO2 Elisa Kits ranked by validation data
- Compare Top AGO2 Elisa Kits
- antibodies-online: Show 11 available AGO2 Proteins ranked by validation data
- Compare Top AGO2 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for AGO2
- Search Santa Cruz Biotechnology (SCBT) for AGO2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for AGO2
- genomics-online: cdna clones - Search for available AGO2 CDNA products
- Overview of 152 available AGO2 gene related products
- orf clones - Search for available AGO2 ORF products
- Overview of 152 available AGO2 gene related products
- genomics-online: gRNA clones - Search for available AGO2 gRNA products
- Overview of 152 available AGO2 gene related products
- genomics-online: primer clones - Search for available AGO2 Primer products
- Overview of 152 available AGO2 gene related products
- genomics-online: shRNA clones - Search for available AGO2 shRNA products
- Overview of 152 available AGO2 gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for AGO2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for AGO2
- Search GeneCopoeia for miRNA 3'UTR Target clone products for AGO2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for AGO2
Sources for AGO2 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20)