Aliases for AGO2 Gene
Aliases for AGO2 Gene
- Argonaute 2, RISC Catalytic Component 2 3 5
- Argonaute RISC Catalytic Component 2 2 3 4
- Cancer Susceptibility Candidate 7 (Non-Protein Coding) 2 3
- Eukaryotic Translation Initiation Factor 2C, 2 2 3
- PAZ Piwi Domain Protein 3 4
- Protein Slicer 3 4
- EIF2C2 3 4
- PPD 3 4
- Eukaryotic Translation Initiation Factor 2C 2 4
- Long Intergenic Non-Protein Coding RNA 980 3
- Cancer Susceptibility Candidate 7 3
- Protein Argonaute-2 3
External Ids for AGO2 Gene
- HGNC: 3263
- Entrez Gene: 27161
- Ensembl: ENSG00000123908
- OMIM: 606229
- UniProtKB: Q9UKV8
Previous HGNC Symbols for AGO2 Gene
- EIF2C2
- CASC7
Previous GeneCards Identifiers for AGO2 Gene
- GC08M141542
- GC08M140531
Summaries for AGO2 Gene
-
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
GeneCards Summary for AGO2 Gene
AGO2 (Argonaute 2, RISC Catalytic Component) is a Protein Coding gene. Diseases associated with AGO2 include Chromosome 18P Deletion Syndrome and Gum Cancer. Among its related pathways are RET signaling and Mitotic Prophase. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is AGO1.
UniProtKB/Swiss-Prot for AGO2 Gene
-
Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The minimal RISC appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3 untranslated region (3-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.
Additional gene information for AGO2 Gene
- Monarch Initiative
- Search for AGO2 at DataMed
- Search for AGO2 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for AGO2 Gene
Genomics for AGO2 Gene
GeneHancer (GH) Regulatory Elements for AGO2 Gene
Promoters and enhancers for AGO2 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around AGO2 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for AGO2 Gene
Genomic Locations for AGO2 Gene
- chr8:140,520,156-140,642,326
- (GRCh38/hg38)
- Size:
- 122,171 bases
- Orientation:
- Minus strand
- chr8:141,541,264-141,645,718
- (GRCh37/hg19)
Genomic View for AGO2 Gene
Genes around AGO2 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 8q24.3 by Ensembl
- 8q24.3 by Entrez Gene
- 8q24.3 by HGNC
AGO2 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for AGO2 Gene
Proteins for AGO2 Gene
-
Protein details for AGO2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9UKV8-AGO2_HUMAN
- Recommended name:
- Protein argonaute-2
- Protein Accession:
- Q9UKV8
- Q8TCZ5
- Q8WV58
- Q96ID1
Protein attributes for AGO2 Gene
- Size:
- 859 amino acids
- Molecular mass:
- 97208 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Interacts with DICER1 through its Piwi domain and with TARBP2 during assembly of the RNA-induced silencing complex (RISC). Together, DICER1, AGO2 and TARBP2 constitute the trimeric RISC loading complex (RLC), or micro-RNA (miRNA) loading complex (miRLC). Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. Note however that the term RISC has also been used to describe the trimeric RLC/miRLC. The formation of RISC complexes containing siRNAs rather than miRNAs appears to occur independently of DICER1. Interacts with AGO1. Also interacts with DDB1, DDX5, DDX6, DDX20, DHX30, DHX36, DDX47, DHX9, ELAVL, FXR1, GEMIN4, HNRNPF, IGF2BP1, ILF3, IMP8, MATR3, PABPC1, PRMT5, P4HA1, P4HB, RBM4, SART3, TNRC6A, TNRC6B, UPF1 and YBX1. Interacts with the P-body components DCP1A and XRN1. Associates with polysomes and messenger ribonucleoproteins (mNRPs). Interacts with RBM4; the interaction is modulated under stress-induced conditions, occurs under both cell proliferation and differentiation conditions and in an RNA- and phosphorylation-independent manner. Interacts with LIMD1, WTIP and AJUBA. Interacts with TRIM71; the interaction increases in presence of RNA (PubMed:23125361). Interacts with APOBEC3G in an RNA-dependent manner. Interacts with APOBEC3A, APOBEC3C, APOBEC3F and APOBEC3H. Interacts with DICER1, TARBP2, EIF6, MOV10 and RPL7A (60S ribosome subunit); they form a large RNA-induced silencing complex (RISC) (PubMed:17507929). Interacts with FMR1 (PubMed:14703574). Interacts with ZFP36 (PubMed:15766526).
- SequenceCaution:
-
- Sequence=AAH07633.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AAL76093.1; Type=Miscellaneous discrepancy; Note=cDNA contains a duplication of an internal sequence at the 5 end.; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for AGO2 Gene
Protein Expression for AGO2 Gene
Selected DME Specific Peptides for AGO2 Gene
- Q9UKV8:
-
- NERVGKSGNIPAGTTVDTKITHP
- QIFGDRKPVFDGRKNLYTAMPLPI
- GRTIKLQANFFEMDIPKIDIYHYELDIKPEK
- EFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQIL
- QALDVVMRHLPSMRYTPVGRSFFTASEGC
- MTDVTGRVLQPPSILYGGR
- KAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQC
- CVSLQALHDALSGRLP
- CEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHC
- NPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKA
Post-translational modifications for AGO2 Gene
- Hydroxylated. 4-hydroxylation appears to enhance protein stability but is not required for miRNA-binding or endonuclease activity.
- Ubiquitination at posLast=550550
- Modification sites at PhosphoSitePlus
Other Protein References for AGO2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for AGO2
-
Abcam antibodies for AGO2
- Invitrogen Antibodies for AGO2
- GeneTex AGO2 antibody for AGO2
-
Santa Cruz Biotechnology (SCBT) Antibodies for AGO2
- Sino Biological Antibodies for AGO2
Protein Products
-
OriGene Purified Proteins for AGO2
- Search Origene for MassSpec and Protein Over-expression Lysates for AGO2
- Origene Custom Protein Services for AGO2
- Sino Biological Cell Lysates for AGO2
- Sino Biological Recombinant Proteins for AGO2
- Search GeneTex for Proteins for AGO2
-
Abcam proteins for AGO2
Assay Products
Domains & Families for AGO2 Gene
Gene Families for AGO2 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for AGO2 Gene
Suggested Antigen Peptide Sequences for AGO2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9UKV8UniProtKB/Swiss-Prot:
AGO2_HUMAN :- The Piwi domain may perform RNA cleavage by a mechanism similar to that of RNase H. However, while RNase H utilizes a triad of Asp-Asp-Glu (DDE) for metal ion coordination, this protein appears to utilize a triad of Asp-Asp-His (DDH).
- Belongs to the argonaute family. Ago subfamily.
- Domain:
-
- The Piwi domain may perform RNA cleavage by a mechanism similar to that of RNase H. However, while RNase H utilizes a triad of Asp-Asp-Glu (DDE) for metal ion coordination, this protein appears to utilize a triad of Asp-Asp-His (DDH).
- Family:
-
- Belongs to the argonaute family. Ago subfamily.
Function for AGO2 Gene
Molecular function for AGO2 Gene
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=1.1 nM for a synthetic 21-nucleotide single-stranded RNA {ECO:0000269 PubMed:15105377, ECO:0000269 PubMed:15800637};
- UniProtKB/Swiss-Prot CatalyticActivity:
- Endonucleolytic cleavage to 5-phosphomonoester.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by EDTA.
- UniProtKB/Swiss-Prot Function:
- Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The minimal RISC appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3 untranslated region (3-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.
Enzyme Numbers (IUBMB) for AGO2 Gene
Phenotypes From GWAS Catalog for AGO2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000340 | RNA 7-methylguanosine cap binding | IDA | 17524464 |
| GO:0000993 | RNA polymerase II core binding | IDA | 25336585 |
| GO:0001047 | core promoter binding | IMP | 25336585 |
| GO:0003676 | nucleic acid binding | IEA | -- |
| GO:0003723 | RNA binding | HDA,IEA | 22658674 |
Phenotypes for AGO2 Gene
- MGI mutant phenotypes for AGO2:
-
inferred from 6 alleles
- nervous system phenotype
- normal phenotype
- homeostasis/metabolism phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- growth/size/body region phenotype
- endocrine/exocrine gland phenotype
- integument phenotype
- embryo phenotype
- hematopoietic system phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for AGO2:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for AGO2
-
-
ViGene Biosciences lentiviral particle packaged cDNA for AGO2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for AGO2 gene
- Search ViGene Biosciences for AGO2
CRISPR Products
-
OriGene CRISPR knockouts for AGO2
- genomics-online: gRNA clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
- Applied Biological Materials CRISPR for AGO2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for AGO2
- GenScript: Design CRISPR guide RNA sequences for AGO2
miRNA for AGO2 Gene
- miRTarBase miRNAs that target AGO2
-
- hsa-mir-376a-3p (MIRT007020)
- hsa-mir-215-5p (MIRT024741)
- hsa-mir-192-5p (MIRT026680)
- hsa-mir-107 (MIRT026970)
- hsa-mir-99a-5p (MIRT027394)
- hsa-mir-21-5p (MIRT031016)
- hsa-mir-16-5p (MIRT031917)
- hsa-mir-671-5p (MIRT039278)
- hsa-mir-652-3p (MIRT039512)
- hsa-mir-186-5p (MIRT045258)
- hsa-mir-30d-5p (MIRT047789)
- hsa-mir-30a-5p (MIRT049935)
- hsa-let-7e-5p (MIRT051431)
- hsa-let-7b-5p (MIRT052006)
- hsa-let-7a-5p (MIRT052575)
- hsa-mir-3120-3p (MIRT224538)
- hsa-mir-3133 (MIRT363351)
- hsa-mir-184 (MIRT437895)
- hsa-mir-4795-3p (MIRT482264)
- hsa-mir-223-5p (MIRT482266)
- hsa-mir-5193 (MIRT482267)
- hsa-mir-3934-5p (MIRT482268)
- hsa-mir-764 (MIRT482269)
- hsa-mir-5002-5p (MIRT482270)
- hsa-mir-125a-3p (MIRT482271)
- hsa-mir-126-5p (MIRT482272)
- hsa-mir-548l (MIRT482273)
- hsa-mir-559 (MIRT482274)
- hsa-mir-548y (MIRT482275)
- hsa-mir-548o-5p (MIRT482276)
- hsa-mir-548w (MIRT482277)
- hsa-mir-548j-5p (MIRT482278)
- hsa-mir-548i (MIRT482279)
- hsa-mir-548h-5p (MIRT482280)
- hsa-mir-548d-5p (MIRT482281)
- hsa-mir-548bb-5p (MIRT482282)
- hsa-mir-548c-5p (MIRT482283)
- hsa-mir-548b-5p (MIRT482284)
- hsa-mir-548ay-5p (MIRT482285)
- hsa-mir-548au-5p (MIRT482286)
- hsa-mir-548as-5p (MIRT482287)
- hsa-mir-548ar-5p (MIRT482288)
- hsa-mir-548ap-5p (MIRT482289)
- hsa-mir-548aq-5p (MIRT482290)
- hsa-mir-548am-5p (MIRT482291)
- hsa-mir-548ak (MIRT482292)
- hsa-mir-548ae-5p (MIRT482293)
- hsa-mir-548ad-5p (MIRT482294)
- hsa-mir-548ab (MIRT482295)
- hsa-mir-6887-5p (MIRT482296)
- hsa-mir-548a-5p (MIRT482297)
- hsa-mir-6795-5p (MIRT482298)
- hsa-mir-7111-5p (MIRT482299)
- hsa-mir-6870-5p (MIRT482300)
- hsa-mir-5698 (MIRT482301)
- hsa-mir-8085 (MIRT482302)
- hsa-mir-4723-5p (MIRT482303)
- hsa-mir-6731-5p (MIRT482304)
- hsa-mir-4644 (MIRT482305)
- hsa-mir-4306 (MIRT482306)
- hsa-mir-185-5p (MIRT482307)
- hsa-mir-6133 (MIRT482308)
- hsa-mir-6129 (MIRT482309)
- hsa-mir-6130 (MIRT482310)
- hsa-mir-6127 (MIRT482311)
- hsa-mir-4510 (MIRT482312)
- hsa-mir-4419a (MIRT482313)
- hsa-mir-4524a-3p (MIRT482314)
- hsa-mir-6794-5p (MIRT482315)
- hsa-mir-4716-3p (MIRT482316)
- hsa-mir-4739 (MIRT482317)
- hsa-mir-4756-5p (MIRT482318)
- hsa-mir-1321 (MIRT482319)
- hsa-mir-6873-5p (MIRT482320)
- hsa-mir-4507 (MIRT482321)
- hsa-mir-3940-5p (MIRT482322)
- hsa-mir-6751-5p (MIRT482323)
- hsa-mir-6803-5p (MIRT482324)
- hsa-mir-7109-5p (MIRT482325)
- hsa-mir-4665-5p (MIRT482326)
- hsa-mir-6811-5p (MIRT482327)
- hsa-mir-1275 (MIRT482328)
- hsa-mir-6511b-5p (MIRT482329)
- hsa-mir-6793-5p (MIRT482330)
- hsa-mir-92a-1-5p (MIRT482331)
- hsa-mir-6769b-5p (MIRT482332)
- hsa-mir-92a-2-5p (MIRT482333)
- hsa-mir-6769a-5p (MIRT482334)
- hsa-mir-654-5p (MIRT482335)
- hsa-mir-541-3p (MIRT482336)
- hsa-mir-5010-5p (MIRT482337)
- hsa-mir-4525 (MIRT482338)
- hsa-mir-6878-5p (MIRT482339)
- hsa-mir-625-5p (MIRT482340)
- hsa-mir-1193 (MIRT482341)
- hsa-mir-4722-5p (MIRT482342)
- hsa-mir-1286 (MIRT482343)
- hsa-mir-6841-3p (MIRT482344)
- hsa-mir-873-5p (MIRT482345)
- hsa-mir-6895-5p (MIRT482346)
- hsa-mir-583 (MIRT482347)
- hsa-mir-6825-5p (MIRT482348)
- hsa-mir-3144-5p (MIRT482349)
- hsa-mir-6781-5p (MIRT482350)
- hsa-mir-6883-5p (MIRT482351)
- hsa-mir-6785-5p (MIRT482352)
- hsa-mir-4728-5p (MIRT482353)
- hsa-mir-149-3p (MIRT482354)
- hsa-mir-3649 (MIRT482355)
- hsa-mir-6797-5p (MIRT482356)
- hsa-mir-6077 (MIRT482357)
- hsa-mir-1249-5p (MIRT482358)
- hsa-mir-6836-5p (MIRT482359)
- hsa-mir-6132 (MIRT482360)
- hsa-mir-6889-5p (MIRT482361)
- hsa-mir-6777-5p (MIRT482362)
- hsa-mir-3918 (MIRT482363)
- hsa-mir-761 (MIRT482364)
- hsa-mir-3619-5p (MIRT482365)
- hsa-mir-214-3p (MIRT482366)
- hsa-mir-6822-5p (MIRT482367)
- hsa-mir-6750-5p (MIRT482368)
- hsa-mir-6165 (MIRT482369)
- hsa-mir-15a-5p (MIRT482370)
- hsa-mir-15b-5p (MIRT482371)
- hsa-mir-195-5p (MIRT482372)
- hsa-mir-424-5p (MIRT482373)
- hsa-mir-497-5p (MIRT482374)
- hsa-mir-6838-5p (MIRT482376)
- hsa-mir-3175 (MIRT485882)
- hsa-mir-6856-5p (MIRT485883)
- hsa-mir-6758-5p (MIRT485884)
- hsa-mir-8055 (MIRT503164)
- hsa-mir-8081 (MIRT503165)
- hsa-mir-627-5p (MIRT503166)
- hsa-mir-937-5p (MIRT503167)
- hsa-mir-4785 (MIRT503168)
- hsa-mir-6755-3p (MIRT503169)
- hsa-mir-3613-3p (MIRT503170)
- hsa-mir-5094 (MIRT503171)
- hsa-mir-944 (MIRT503172)
- hsa-mir-548c-3p (MIRT503173)
- hsa-mir-148b-3p (MIRT503174)
- hsa-mir-152-3p (MIRT503175)
- hsa-mir-148a-3p (MIRT503176)
- hsa-mir-374b-3p (MIRT503177)
- hsa-mir-4766-3p (MIRT503178)
- hsa-mir-6792-5p (MIRT503179)
- hsa-mir-4522 (MIRT503180)
- hsa-mir-646 (MIRT503181)
- hsa-mir-548p (MIRT503182)
- hsa-mir-3664-5p (MIRT503183)
- hsa-mir-590-5p (MIRT503184)
- hsa-mir-4799-5p (MIRT514048)
- hsa-mir-506-5p (MIRT514049)
- hsa-mir-6074 (MIRT514050)
- hsa-mir-892c-5p (MIRT514051)
- hsa-mir-103a-3p (MIRT514052)
- hsa-mir-491-3p (MIRT524987)
- hsa-mir-4509 (MIRT524988)
- hsa-mir-4699-3p (MIRT524989)
- hsa-mir-3680-3p (MIRT539343)
- hsa-mir-302c-5p (MIRT539344)
- hsa-mir-33b-5p (MIRT539345)
- hsa-mir-33a-5p (MIRT539346)
- hsa-mir-195-3p (MIRT539347)
- hsa-mir-16-2-3p (MIRT539348)
- hsa-mir-802 (MIRT539349)
- hsa-mir-3908 (MIRT539350)
- hsa-mir-4703-5p (MIRT539351)
- hsa-mir-3942-5p (MIRT539352)
- hsa-mir-7-2-3p (MIRT539353)
- hsa-mir-7-1-3p (MIRT539354)
- hsa-mir-3121-3p (MIRT539355)
- hsa-mir-548t-5p (MIRT539356)
- hsa-mir-548az-5p (MIRT539357)
- hsa-mir-548n (MIRT539358)
- hsa-mir-4744 (MIRT549405)
- hsa-mir-548e-5p (MIRT549406)
- hsa-mir-4666a-5p (MIRT559690)
- hsa-mir-548v (MIRT559691)
- hsa-mir-187-5p (MIRT559692)
- hsa-mir-222-3p (MIRT559693)
- hsa-mir-221-3p (MIRT559694)
- hsa-mir-95-5p (MIRT559695)
- hsa-mir-5688 (MIRT559696)
- hsa-mir-495-3p (MIRT559697)
- hsa-mir-4495 (MIRT568582)
- hsa-mir-5582-5p (MIRT568583)
- hsa-mir-4719 (MIRT568584)
- hsa-mir-4803 (MIRT568585)
- hsa-mir-5692a (MIRT568586)
- hsa-mir-548an (MIRT568587)
- hsa-mir-382-3p (MIRT568588)
- hsa-mir-124-3p (MIRT568589)
- hsa-mir-6763-5p (MIRT572259)
- hsa-mir-3150a-3p (MIRT572260)
- hsa-mir-6783-3p (MIRT572261)
- hsa-mir-1343-3p (MIRT572262)
- hsa-mir-939-5p (MIRT572263)
- hsa-mir-1343-5p (MIRT572264)
- hsa-mir-6827-5p (MIRT572265)
- hsa-mir-505-5p (MIRT572266)
- hsa-mir-8089 (MIRT572267)
- hsa-mir-4700-5p (MIRT572268)
- hsa-mir-4667-5p (MIRT572269)
- hsa-mir-6852-5p (MIRT572270)
- hsa-mir-6742-3p (MIRT572271)
- hsa-mir-939-3p (MIRT572272)
- hsa-mir-8064 (MIRT613332)
- hsa-mir-1911-5p (MIRT613333)
- hsa-mir-4682 (MIRT613334)
- hsa-mir-4653-5p (MIRT613335)
- hsa-mir-3921 (MIRT613336)
- hsa-mir-6777-3p (MIRT613337)
- hsa-mir-4714-5p (MIRT613338)
- hsa-mir-362-3p (MIRT613339)
- hsa-mir-329-3p (MIRT613340)
- hsa-mir-8485 (MIRT613341)
- hsa-mir-513b-5p (MIRT636724)
- hsa-mir-6837-3p (MIRT636725)
- hsa-mir-6754-3p (MIRT636726)
- hsa-mir-412-3p (MIRT636727)
- hsa-mir-145-3p (MIRT660842)
- hsa-mir-466 (MIRT660843)
- hsa-mir-4643 (MIRT660844)
- hsa-mir-576-5p (MIRT683216)
- hsa-mir-4263 (MIRT683217)
- hsa-mir-211-5p (MIRT683218)
- hsa-mir-204-5p (MIRT683219)
- hsa-mir-524-5p (MIRT683220)
- hsa-mir-520d-5p (MIRT683221)
- hsa-mir-31-3p (MIRT683222)
- hsa-mir-6832-3p (MIRT683223)
- hsa-mir-4328 (MIRT683224)
- hsa-mir-8054 (MIRT683225)
- hsa-mir-548k (MIRT683226)
- hsa-mir-548av-5p (MIRT683227)
- hsa-mir-578 (MIRT708212)
- hsa-mir-132-3p (MIRT734062)
- hsa-mir-1207-5p (MIRT736003)
- hsa-mir-1255a (MIRT736566)
- hsa-mir-1255b-5p (MIRT736589)
- hsa-mir-1298-3p (MIRT737235)
- hsa-mir-204-3p (MIRT738818)
- hsa-mir-3192-5p (MIRT741003)
- hsa-mir-3197 (MIRT741095)
- hsa-mir-3616-3p (MIRT741659)
- hsa-mir-3691-3p (MIRT742517)
- hsa-mir-3910 (MIRT742832)
- hsa-mir-4270 (MIRT743547)
- hsa-mir-4314 (MIRT743974)
- hsa-mir-4441 (MIRT744514)
- hsa-mir-4646-5p (MIRT746427)
- hsa-mir-4668-3p (MIRT746809)
- hsa-mir-4763-3p (MIRT748512)
- hsa-mir-510-3p (MIRT749723)
- hsa-mir-5187-5p (MIRT749853)
- hsa-mir-542-5p (MIRT750417)
- hsa-mir-602 (MIRT751627)
- hsa-mir-605-3p (MIRT751641)
- hsa-mir-6087 (MIRT751894)
- hsa-mir-6125 (MIRT752066)
- hsa-mir-619-5p (MIRT752536)
- hsa-mir-6506-5p (MIRT752945)
- hsa-mir-658 (MIRT753508)
- hsa-mir-6754-5p (MIRT754689)
- hsa-mir-6765-5p (MIRT755069)
- hsa-mir-6804-5p (MIRT756418)
- hsa-mir-6820-5p (MIRT756876)
- hsa-mir-8063 (MIRT760047)
- hsa-mir-92b-5p (MIRT760664)
- hsa-mir-10b-3p (MIRT761153)
- hsa-mir-181b-2-3p (MIRT762971)
- hsa-mir-181b-3p (MIRT762974)
- hsa-mir-2115-5p (MIRT763810)
- hsa-mir-2277-3p (MIRT763981)
- hsa-mir-34c-3p (MIRT765818)
- hsa-mir-3619-3p (MIRT766101)
- hsa-mir-3620-3p (MIRT766108)
- hsa-mir-3660 (MIRT766450)
- hsa-mir-3690 (MIRT767113)
- hsa-mir-4256 (MIRT768095)
- hsa-mir-4308 (MIRT768532)
- hsa-mir-4420 (MIRT768827)
- hsa-mir-4526 (MIRT770052)
- hsa-mir-4690-3p (MIRT771074)
- hsa-mir-4755-5p (MIRT771952)
- hsa-mir-4776-5p (MIRT772229)
- hsa-mir-5006-3p (MIRT772938)
- hsa-mir-504-5p (MIRT773087)
- hsa-mir-516a-3p (MIRT773451)
- hsa-mir-516b-3p (MIRT773456)
- hsa-mir-520a-3p (MIRT773748)
- hsa-mir-5685 (MIRT774960)
- hsa-mir-623 (MIRT776083)
- hsa-mir-6719-3p (MIRT777710)
- hsa-mir-6730-3p (MIRT777967)
- hsa-mir-6856-3p (MIRT780479)
- hsa-mir-7162-5p (MIRT781692)
miRNA Products
- Search ViGene Biosciences for AGO2
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for AGO2
- Browse OriGene Inhibitory RNA Products For AGO2
- genomics-online: shRNA clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for AGO2 gene
Clone Products
- Sino Biological Human cDNA Clone for AGO2
- VectorBuilder custom plasmid, inducible vectors for AGO2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for AGO2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for AGO2
- Applied Biological Materials Clones for AGO2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for AGO2 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for AGO2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for AGO2 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for AGO2 Gene
Localization for AGO2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for AGO2 Gene
- Cytoplasm, P-body. Nucleus. Note=Translational repression of mRNAs results in their recruitment to P-bodies. Translocation to the nucleus requires IMP8.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| nucleus | 5 |
| cytosol | 5 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| endosome | 1 |
- Nucleoplasm (3)
- Cell Junctions (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000932 | P-body | IEA,IDA | 20616046 |
| GO:0005634 | nucleus | IEA,IC | 25336585 |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005737 | cytoplasm | IDA,IEA | 15260970 |
| GO:0005829 | cytosol | TAS | -- |
Pathways & Interactions for AGO2 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | RET signaling |
.92
|
|
| 2 | PI3K/AKT activation |
.89
|
|
| 3 | CDK-mediated phosphorylation and removal of Cdc6 |
.41
|
|
| 4 | Mitotic Prophase | ||
| 5 | Pre-NOTCH Expression and Processing | ||
Pathways by source for AGO2 Gene
36 Reactome pathways for AGO2 Gene
3 Qiagen pathways for AGO2 Gene
1 Cell Signaling Technology pathway for AGO2 Gene
Interacting Proteins for AGO2 Gene
Selected Interacting proteins:
ENSP00000220592
Q9UKV8-AGO2_HUMAN
for AGO2 Gene via
STRING
MINT
IID
UniProtKB
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006351 | transcription, DNA-templated | IEA | -- |
| GO:0006355 | regulation of transcription, DNA-templated | IEA | -- |
| GO:0006412 | translation | NAS | 10534406 |
| GO:0006413 | translational initiation | IEA | -- |
| GO:0006417 | regulation of translation | IEA | -- |
No data available for SIGNOR curated interactions for AGO2 Gene
Transcripts for AGO2 Gene
mRNA/cDNA for AGO2 Gene
- (6) REFSEQ mRNAs :
- (15) Additional mRNA sequences :
- (278) Selected AceView cDNA sequences:
- (10) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for AGO2 Gene
CRISPR Products
-
OriGene CRISPR knockouts for AGO2
- genomics-online: gRNA clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
- Applied Biological Materials CRISPR for AGO2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for AGO2
- GenScript: Design CRISPR guide RNA sequences for AGO2
miRNA Products
- Search ViGene Biosciences for AGO2
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for AGO2
- Browse OriGene Inhibitory RNA Products For AGO2
- genomics-online: shRNA clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for AGO2 gene
Clone Products
- Sino Biological Human cDNA Clone for AGO2
- VectorBuilder custom plasmid, inducible vectors for AGO2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for AGO2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for AGO2
- Applied Biological Materials Clones for AGO2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Expression for AGO2 Gene
mRNA differential expression in normal tissues according to GTEx for AGO2 Gene
This gene is overexpressed in Whole Blood (x7.5) and Muscle - Skeletal (x4.3).
This gene is overexpressed in Bone marrow stromal cell (10.1) and Lymph node (9.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for AGO2 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of AGO2 Gene:
AGO2SOURCE GeneReport for Unigene cluster for AGO2 Gene:
Hs.743313Evidence on tissue expression from TISSUES for AGO2 Gene
- Nervous system(4.5)
- Eye(4.3)
- Bone marrow(2.5)
- Blood(2.3)
- Heart(2.1)
- Liver(2.1)
- Skin(2)
Primer Products
-
OriGene qPCR primer pairs for AGO2
- genomics-online: primer clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for AGO2 Gene
Orthologs for AGO2 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | EIF2C2 33 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | AGO2 34 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | AGO2 34 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | AGO2 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | EIF2C2 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Ago2 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Ago2 33 |
|
||
| chicken (Gallus gallus) |
Aves | AGO2 34 |
|
OneToOne | |
| LOC100858102 33 |
|
||||
| lizard (Anolis carolinensis) |
Reptilia | AGO2 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | ago2 33 |
|
||
| Str.15011 33 |
|
||||
| zebrafish (Danio rerio) |
Actinopterygii | CU929240.1 34 |
|
OneToOne | |
| LOC570630 33 |
|
||||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP011717 33 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | AGO1 33 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | alg-1 33 |
|
||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | AGO5 33 |
|
||
| soybean (Glycine max) |
eudicotyledons | Gma.5747 33 |
|
- Species where no ortholog for AGO2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for AGO2 Gene
Variants for AGO2 Gene
| SNP ID | Clin | Chr 08 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000003326 | -- | 140,563,853(-) | C/T | intron_variant | |
| rs1000010494 | -- | 140,624,471(-) | C/T | genic_upstream_transcript_variant, intron_variant | |
| rs1000026264 | -- | 140,624,227(-) | C/T | genic_upstream_transcript_variant, intron_variant | |
| rs1000061020 | -- | 140,569,289(-) | G/A | intron_variant | |
| rs1000091882 | -- | 140,569,563(-) | G/A | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv1712972 | CNV | deletion | 17803354 |
| esv24351 | CNV | loss | 19812545 |
| esv2539959 | CNV | deletion | 19546169 |
| esv2737756 | CNV | deletion | 23290073 |
| esv2737758 | CNV | deletion | 23290073 |
| nsv1016282 | CNV | gain | 25217958 |
| nsv1025478 | CNV | gain | 25217958 |
| nsv1115144 | CNV | deletion | 24896259 |
| nsv1126125 | CNV | deletion | 24896259 |
| nsv1137621 | CNV | deletion | 24896259 |
| nsv1144237 | CNV | deletion | 24896259 |
| nsv465952 | CNV | loss | 19166990 |
| nsv512075 | CNV | loss | 21212237 |
| nsv526444 | CNV | gain | 19592680 |
| nsv612568 | CNV | gain | 21841781 |
| nsv612569 | CNV | loss | 21841781 |
| nsv612570 | CNV | gain | 21841781 |
| nsv6427 | CNV | insertion | 18451855 |
| nsv824748 | CNV | gain | 20364138 |
Residual Variation Intolerance Score:
2.86% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.13;
2.90% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for AGO2 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for AGO2 Gene
Disorders for AGO2 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| chromosome 18p deletion syndrome |
|
|
| gum cancer |
|
|
| extraskeletal mesenchymal chondrosarcoma |
|
|
| patau syndrome |
|
|
| breast malignant phyllodes tumor |
|
|
Search AGO2 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for AGO2
No data available for UniProtKB/Swiss-Prot and Genatlas for AGO2 Gene
Publications for AGO2 Gene
- In vitro reconstitution of the human RISC-loading complex. (PMID: 18178619) MacRae IJ … Doudna JA (Proceedings of the National Academy of Sciences of the United States of America 2008) 3 4 22 58
- Translation repression in human cells by microRNA-induced gene silencing requires RCK/p54. (PMID: 16756390) Chu CY … Rana TM (PLoS biology 2006) 3 4 22 58
- A human, ATP-independent, RISC assembly machine fueled by pre-miRNA. (PMID: 16357216) Maniataki E … Mourelatos Z (Genes & development 2005) 3 4 22 58
- Characterization of the interactions between mammalian PAZ PIWI domain proteins and Dicer. (PMID: 14749716) Tahbaz N … Hobman TC (EMBO reports 2004) 3 4 22 58
- Human eukaryotic initiation factor EIF2C1 gene: cDNA sequence, genomic organization, localization to chromosomal bands 1p34-p35, and expression. (PMID: 10534406) Koesters R … Briner J (Genomics 1999) 2 3 4 58
Products for AGO2 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for AGO2
- Search Origene for MassSpec and Protein Over-expression Lysates for AGO2
- Origene Custom Protein Services for AGO2
- Origene shrna and RNAi products in human, mouse, rat for AGO2
- Browse OriGene Inhibitory RNA Products For AGO2
- OriGene qPCR primer pairs for AGO2
- OriGene CRISPR knockouts for AGO2
- OriGene ORF clones in human for AGO2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For AGO2
- GenScript: Next-day shipping of latest version cDNA ORF clones for AGO2 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for AGO2
- GenScript Custom Assay Services for AGO2
- GenScript Custom overexpressing Cell Line Services for AGO2
- GenScript: Design CRISPR guide RNA sequences for AGO2
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for AGO2
- Sino Biological Human cDNA Clone for AGO2
- Sino Biological Recombinant Proteins for AGO2
- Sino Biological Cell Lysates for AGO2
- Sino Biological Antibodies for AGO2
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for AGO2
- Novus Biologicals lysates and proteins for AGO2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for AGO2
- Abcam proteins for AGO2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Cyagen custom Knockout/knockin (KOKI) mouse models for AGO2
- VectorBuilder custom plasmid, inducible vectors for AGO2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for AGO2
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for AGO2
- antibodies-online: Search results for 74 available AGO2 Antibodies ranked by validation data
- Compare Top AGO2 Antibodies
- antibodies-online: Search results for 8 available AGO2 Elisa Kits ranked by validation data
- Compare Top AGO2 Elisa Kits
- antibodies-online: Search results for 17 available AGO2 Proteins ranked by validation data
- Compare Top AGO2 Proteins
- GeneTex AGO2 antibody for AGO2
- Search GeneTex for Proteins for AGO2
- ViGene Biosciences adenoviral particle packaged cDNA for AGO2 gene
- ViGene Biosciences lentiviral particle packaged cDNA for AGO2 gene
- ViGene Biosciences ready-to-package AAV shRNAs for AGO2 gene
- Search ViGene Biosciences for AGO2
- Santa Cruz Biotechnology (SCBT) Antibodies for AGO2
- Search Santa Cruz Biotechnology (SCBT) for AGO2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for AGO2
- genomics-online: cdna clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
- orf clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
- genomics-online: gRNA clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
- genomics-online: primer clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
- genomics-online: shRNA clones - Search results for 132 available AGO2 gene related products
- Overview of 132 available AGO2 gene related products
Sources for AGO2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems