The protein encoded by this gene belongs to a distinct class of adenylyl cyclases that is soluble and insensitive to G protein or forskolin regulation. Activity of this protein is regulated by bicarbonate. Variation at this gene has been observed in patients with absorptive hypercalciuria. Alternatively spliced transcript variants encoding different isoforms have been observed.... See more...

Aliases for ADCY10 Gene

Aliases for ADCY10 Gene

  • Adenylate Cyclase 10 2 3 5
  • SAC 3 4 4
  • Germ Cell Soluble Adenylyl Cyclase 3 4
  • Adenylate Cyclase 10, Soluble 2 3
  • Adenylate Cyclase Type 10 3 4
  • AH-Related Protein 3 4
  • EC 4.6.1.1 4 54
  • HsAC 3 4
  • Epididymis Secretory Sperm Binding Protein Li 7a 3
  • Testicular Soluble Adenylyl Cyclase (SAC) 3
  • Testicular Soluble Adenylyl Cyclase 4
  • Hypercalciuria, Absorptive, 2 2
  • 3',5'-Cyclic AMP Synthetase 3
  • Adenylate Cyclase Homolog 4
  • Soluble Adenylyl Cyclase 2
  • ATP Pyrophosphate-Lyase 3
  • HEL-S-7a 3
  • HCA2 3
  • SACI 3
  • Sacy 3

External Ids for ADCY10 Gene

Previous GeneCards Identifiers for ADCY10 Gene

  • GC01M166046
  • GC01M167778
  • GC01M139024

Summaries for ADCY10 Gene

Entrez Gene Summary for ADCY10 Gene

  • The protein encoded by this gene belongs to a distinct class of adenylyl cyclases that is soluble and insensitive to G protein or forskolin regulation. Activity of this protein is regulated by bicarbonate. Variation at this gene has been observed in patients with absorptive hypercalciuria. Alternatively spliced transcript variants encoding different isoforms have been observed. There is a pseudogene of this gene on chromosome 6. [provided by RefSeq, Jul 2014]

GeneCards Summary for ADCY10 Gene

ADCY10 (Adenylate Cyclase 10) is a Protein Coding gene. Diseases associated with ADCY10 include Hypercalciuria, Absorptive, 2 and Idiopathic Hypercalciuria. Among its related pathways are Activation of cAMP-Dependent PKA and Sweet Taste Signaling. Gene Ontology (GO) annotations related to this gene include magnesium ion binding and manganese ion binding.

UniProtKB/Swiss-Prot Summary for ADCY10 Gene

  • Catalyzes the formation of the signaling molecule cAMP (PubMed:12609998, PubMed:15659711, PubMed:24616449, PubMed:25040695, PubMed:24567411). May function as sensor that mediates responses to changes in cellular bicarbonate and CO(2) levels (PubMed:15659711, PubMed:17591988). Has a critical role in mammalian spermatogenesis by producing the cAMP which regulates cAMP-responsive nuclear factors indispensable for sperm maturation in the epididymis. Induces capacitation, the maturational process that sperm undergo prior to fertilization (By similarity). Involved in ciliary beat regulation (PubMed:17591988).

Gene Wiki entry for ADCY10 Gene

Additional gene information for ADCY10 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ADCY10 Gene

Genomics for ADCY10 Gene

GeneHancer (GH) Regulatory Elements for ADCY10 Gene

Promoters and enhancers for ADCY10 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01J167933 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 750.3 -21.0 -20984 5.8 SIN3A SP1 ZBTB40 SREBF1 SIX5 LCORL FOXA1 RBPJ SMARCE1 POLR2A MPC2 DCAF6 ADCY10 POU2F1 MPZL1 DPT TIPRL CREG1
GH01J167914 Promoter/Enhancer 1.1 EPDnew Ensembl 750.6 +1.5 1525 0.8 FOXA1 NR2F1 NR2F6 HLF RAD21 ZNF148 SP1 CEBPG PPARG ZNF644 ADCY10 lnc-MPC2-2 piR-30791-004
GH01J167915 Enhancer 1 ENCODE dbSUPER 750.6 -1.4 -1368 2.7 ZNF24 FOXA1 NR2F1 NR2F6 MIXL1 RAD21 ZNF652 ELF3 SP1 CEBPG ADCY10 RF00017-387 MPC2
GH01J167713 Promoter/Enhancer 2.7 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 10.8 +196.9 196943 11.2 GTF3C2 ZNF785 SIN3A ZNF24 ZBTB40 SP1 CTCF ZBTB6 FOXA1 MLX MPZL1 POU2F1 DUTP6 TADA1 TIPRL ENSG00000227722 CNN2P10 FMO11P ADCY10 ENSG00000232194
GH01J167985 Enhancer 1.2 FANTOM5 Ensembl 21.2 -69.1 -69122 1.7 ZNF785 ZBTB40 SMARCE1 ZNF362 ZNF133 CC2D1A ZNF701 L3MBTL2 TEAD4 ZNF280D POU2F1 MPZL1 ADCY10 ENSG00000227722 RPL29P7 DPT MPC2 RCSD1 MIR1255B2 DCAF6
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ADCY10 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the ADCY10 gene promoter:
  • AREB6
  • CREB
  • deltaCREB
  • Nkx2-5
  • NRSF form 1
  • NRSF form 2
  • Sox5
  • Sox9

Genomic Locations for ADCY10 Gene

Genomic Locations for ADCY10 Gene
chr1:167,809,080-167,915,526
(GRCh38/hg38)
Size:
106,447 bases
Orientation:
Minus strand
chr1:167,778,625-167,883,453
(GRCh37/hg19)
Size:
104,829 bases
Orientation:
Minus strand

Genomic View for ADCY10 Gene

Genes around ADCY10 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ADCY10 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ADCY10 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ADCY10 Gene

Proteins for ADCY10 Gene

  • Protein details for ADCY10 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96PN6-ADCYA_HUMAN
    Recommended name:
    Adenylate cyclase type 10
    Protein Accession:
    Q96PN6
    Secondary Accessions:
    • B4DZF0
    • F5GWS5
    • O95558
    • Q5R329
    • Q5R330
    • Q8WXV4
    • Q9NNX0

    Protein attributes for ADCY10 Gene

    Size:
    1610 amino acids
    Molecular mass:
    187149 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for ADCY10 Gene

    Alternative splice isoforms for ADCY10 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ADCY10 Gene

Selected DME Specific Peptides for ADCY10 Gene

Q96PN6:
  • DIFDFCSQVHKI
  • LVAQNTTGPVF
  • TVSIGVASGIVFCGIVGHTVRHEYTVIGQKVN
  • EKVMFGMA
  • SRYMEGQVL
  • LSHQMLVRCAAIIGLTFTTELLFEILPCWNMKMMIK
  • AMYMDRGAEQLVEILNY
  • GYLSELRPVTIVFVNLMF
  • YFFKELPKK
  • GQINKVFMFDKGCSFLCVFGFPGEK
  • ISAIVEKVLIFGGDILKFAGDALLALW
  • MANVLGLDTCKHYKERQTNL

Post-translational modifications for ADCY10 Gene

Domains & Families for ADCY10 Gene

Gene Families for ADCY10 Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for ADCY10 Gene

Suggested Antigen Peptide Sequences for ADCY10 Gene

GenScript: Design optimal peptide antigens:
  • Testicular soluble adenylyl cyclase (ADCYA_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q96PN6

UniProtKB/Swiss-Prot:

ADCYA_HUMAN :
  • The N-terminal guanylate cyclase domains are required for enzyme activity. Fragments or isoforms containing the first 470 amino acid residues are fully active.
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Domain:
  • The N-terminal guanylate cyclase domains are required for enzyme activity. Fragments or isoforms containing the first 470 amino acid residues are fully active.
Family:
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
genes like me logo Genes that share domains with ADCY10: view

Function for ADCY10 Gene

Molecular function for ADCY10 Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the formation of the signaling molecule cAMP (PubMed:12609998, PubMed:15659711, PubMed:24616449, PubMed:25040695, PubMed:24567411). May function as sensor that mediates responses to changes in cellular bicarbonate and CO(2) levels (PubMed:15659711, PubMed:17591988). Has a critical role in mammalian spermatogenesis by producing the cAMP which regulates cAMP-responsive nuclear factors indispensable for sperm maturation in the epididymis. Induces capacitation, the maturational process that sperm undergo prior to fertilization (By similarity). Involved in ciliary beat regulation (PubMed:17591988).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP = 3',5'-cyclic AMP + diphosphate; Xref=Rhea:RHEA:15389, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:58165; EC=4.6.1.1; Evidence={ECO:0000269 PubMed:12609998, ECO:0000269 PubMed:15659711, ECO:0000269 PubMed:24567411, ECO:0000269 PubMed:24616449, ECO:0000269 PubMed:25040695};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by manganese or magnesium ions (PubMed:12609998, PubMed:24616449). In the presence of magnesium ions, the enzyme is activated by bicarbonate (PubMed:12609998, PubMed:15659711, PubMed:24567411). In the presence of manganese ions, the enzyme is inhibited by bicarbonate (PubMed:15659711). In the absence of magnesium and bicarbonate, the enzyme is weakly activated by calcium (PubMed:15659711). Calcium mildly increases the enzyme activity, also in the presence of magnesium ions (PubMed:15659711, PubMed:25040695).
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=0.8 mM for ATP-Mn(2+) {ECO:0000269 PubMed:12609998}; KM=2.41 mM for Mg(2+) {ECO:0000269 PubMed:12609998};

Enzyme Numbers (IUBMB) for ADCY10 Gene

Phenotypes From GWAS Catalog for ADCY10 Gene

Gene Ontology (GO) - Molecular Function for ADCY10 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IEA --
GO:0004016 adenylate cyclase activity NAS,TAS 9874775
GO:0005524 ATP binding IEA --
GO:0016829 lyase activity IEA --
GO:0016849 phosphorus-oxygen lyase activity IEA --
genes like me logo Genes that share ontologies with ADCY10: view
genes like me logo Genes that share phenotypes with ADCY10: view

Human Phenotype Ontology for ADCY10 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for ADCY10 Gene

MGI Knock Outs for ADCY10:

Animal Model Products

  • Taconic Biosciences Mouse Models for ADCY10

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ADCY10

Clone Products

No data available for miRNA , Transcription Factor Targets and HOMER Transcription for ADCY10 Gene

Localization for ADCY10 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ADCY10 Gene

Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cell projection, cilium. Cytoplasm. Mitochondrion. Note=Distributed to subcellular compartments containing cAMP targets. Found as a plasma membrane-associated protein, protein concentrated in the perinuclear region and protein colocalized with actin or tubulin. {ECO:0000269 PubMed:12475901, ECO:0000269 PubMed:15659711}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ADCY10 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 4
mitochondrion 4
extracellular 3
cytoskeleton 3
peroxisome 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for ADCY10 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005634 nucleus IDA,IEA 15659711
GO:0005737 cytoplasm TAS,IBA 21873635
GO:0005739 mitochondrion IEA --
GO:0005829 cytosol NAS 9874775
genes like me logo Genes that share ontologies with ADCY10: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for ADCY10 Gene

Pathways & Interactions for ADCY10 Gene

PathCards logo

SuperPathways for ADCY10 Gene

SuperPathway Contained pathways
1 Activation of cAMP-Dependent PKA
.77
.77
2 Sweet Taste Signaling
.46
.37
3 Signaling by Hedgehog
4 Apelin signaling pathway
5 cAMP signaling pathway
genes like me logo Genes that share pathways with ADCY10: view

Pathways by source for ADCY10 Gene

1 BioSystems pathway for ADCY10 Gene
3 Reactome pathways for ADCY10 Gene
5 Qiagen pathways for ADCY10 Gene
  • Activation of cAMP-Dependent PKA
  • cAMP Pathway
  • Cellular Effects of Sildenafil
  • Sertoli-Sertoli Cell Junction Dynamics
  • Sperm Motility

SIGNOR curated interactions for ADCY10 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for ADCY10 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003351 epithelial cilium movement IMP 17591988
GO:0006171 cAMP biosynthetic process NAS 9874775
GO:0007283 spermatogenesis IEA --
GO:0009190 cyclic nucleotide biosynthetic process IEA --
GO:0035556 intracellular signal transduction IEA --
genes like me logo Genes that share ontologies with ADCY10: view

Drugs & Compounds for ADCY10 Gene

(90) Drugs for ADCY10 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Calcium Approved Nutra 7773
Magnesium Approved, Experimental, Investigational Pharma 0
Manganese Approved Nutra 48
cyclic amp Experimental Pharma 0
Cyclic GMP Experimental Pharma 0

(50) Additional Compounds for ADCY10 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Carbonic acid
  • [co(OH)2]
  • Dihydrogen carbonate
  • H2CO3
  • Koehlensaeure
  • Carbonate
71-52-3, 463-79-6
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8

(8) ApexBio Compounds for ADCY10 Gene

Compound Action Cas Number
1,9-Dideoxyforskolin 64657-18-7
Forskolin 66575-29-9
KH 7 330676-02-3
MDL 12330A hydrochloride adenylate cyclase inhibitor 40297-09-4
N6-methyladenosine (m6A) adenylate cyclase regulator 1867-73-8
NKH 477 138605-00-2
NKY 80 299442-43-6
SQ 22536 17318-31-9
genes like me logo Genes that share compounds with ADCY10: view

Drug Products

Transcripts for ADCY10 Gene

mRNA/cDNA for ADCY10 Gene

(3) REFSEQ mRNAs :
(12) Additional mRNA sequences :
(11) Selected AceView cDNA sequences:
(5) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ADCY10

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for ADCY10 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15a · 15b · 15c ^ 16 ^ 17 ^ 18 ^
SP1: - - -
SP2: - - - -
SP3:
SP4: - -
SP5: -
SP6: -
SP7:
SP8: -

ExUns: 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33 ^ 34 ^ 35 ^ 36a · 36b
SP1: - -
SP2: - -
SP3: - -
SP4:
SP5:
SP6:
SP7: - -
SP8:

Relevant External Links for ADCY10 Gene

GeneLoc Exon Structure for
ADCY10
ECgene alternative splicing isoforms for
ADCY10

Expression for ADCY10 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ADCY10 Gene

mRNA differential expression in normal tissues according to GTEx for ADCY10 Gene

This gene is overexpressed in Testis (x23.6) and Liver (x9.7).

Protein differential expression in normal tissues from HIPED for ADCY10 Gene

This gene is overexpressed in Testis (38.9), Liver, secretome (12.3), Plasma (9.2), and Neutrophil (8.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for ADCY10 Gene



Protein tissue co-expression partners for ADCY10 Gene

NURSA nuclear receptor signaling pathways regulating expression of ADCY10 Gene:

ADCY10

SOURCE GeneReport for Unigene cluster for ADCY10 Gene:

Hs.320892

mRNA Expression by UniProt/SwissProt for ADCY10 Gene:

Q96PN6-ADCYA_HUMAN
Tissue specificity: Detected in airway epithelial cells and testis (at protein level) (PubMed:17591988). Weakly expressed in multiple tissues. Expressed in brain, heart, kidney, liver, lung, pancreas, peripheral blood leukocytes, placenta, skeletal muscle, stomach, thymus, airway epithelial cells, duodenum, jejunum and ileum. Very low level of expression in bone.

Evidence on tissue expression from TISSUES for ADCY10 Gene

  • Intestine(4.3)
  • Kidney(2.7)
  • Urine(2.5)
  • Blood(2.2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for ADCY10 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • nervous
  • skeletal muscle
  • urinary
Regions:
Head and neck:
  • brain
  • ear
  • head
Thorax:
  • heart
Abdomen:
  • duodenum
  • intestine
  • kidney
  • large intestine
  • pancreas
  • small intestine
  • stomach
Pelvis:
  • rectum
  • ureter
genes like me logo Genes that share expression patterns with ADCY10: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery for ADCY10 Gene

Orthologs for ADCY10 Gene

This gene was present in the common ancestor of animals.

Orthologs for ADCY10 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ADCY10 33 32
  • 99.25 (n)
OneToOne
dog
(Canis familiaris)
Mammalia ADCY10 33 32
  • 86.13 (n)
OneToOne
cow
(Bos Taurus)
Mammalia ADCY10 33 32
  • 85.65 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Adcy10 17 33 32
  • 81.77 (n)
rat
(Rattus norvegicus)
Mammalia Adcy10 32
  • 81.35 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 33
  • 67 (a)
OneToMany
-- 33
  • 60 (a)
OneToMany
oppossum
(Monodelphis domestica)
Mammalia ADCY10 33
  • 63 (a)
OneToOne
chicken
(Gallus gallus)
Aves LOC101751665 32
  • 63.25 (n)
-- 33
  • 40 (a)
OneToMany
-- 33
  • 35 (a)
OneToMany
-- 33
  • 35 (a)
OneToMany
-- 33
  • 34 (a)
OneToMany
-- 33
  • 32 (a)
OneToMany
-- 33
  • 31 (a)
OneToMany
lizard
(Anolis carolinensis)
Reptilia ADCY10 33
  • 41 (a)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008683 32
  • 47.79 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 33
  • 37 (a)
OneToOne
Species where no ortholog for ADCY10 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)
  • zebrafish (Danio rerio)

Evolution for ADCY10 Gene

ENSEMBL:
Gene Tree for ADCY10 (if available)
TreeFam:
Gene Tree for ADCY10 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ADCY10: view image

Paralogs for ADCY10 Gene

Pseudogenes.org Pseudogenes for ADCY10 Gene

genes like me logo Genes that share paralogs with ADCY10: view

No data available for Paralogs for ADCY10 Gene

Variants for ADCY10 Gene

Sequence variations from dbSNP and Humsavar for ADCY10 Gene

SNP ID Clin Chr 01 pos Variation AA Info Type
rs779944215 pathogenic, Abnormal sperm morphology, Reduced sperm motility 167,880,125(-) GTGT/GT coding_sequence_variant, frameshift, non_coding_transcript_variant
rs376243653 uncertain-significance, not provided 167,845,698(-) C/A coding_sequence_variant, non_coding_transcript_variant, stop_gained
rs116510137 benign, not specified 167,833,038(-) T/C coding_sequence_variant, genic_downstream_transcript_variant, missense_variant, non_coding_transcript_variant, synonymous_variant
rs1000010148 -- 167,910,092(-) G/T intron_variant
rs1000024035 -- 167,867,244(-) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for ADCY10 Gene

Variant ID Type Subtype PubMed ID
esv2719217 CNV deletion 23290073
esv32660 CNV loss 17666407
esv3309011 CNV mobile element insertion 20981092
esv3328988 CNV insertion 20981092
esv3330175 CNV duplication 20981092
esv3427330 CNV insertion 20981092
nsv1002698 CNV loss 25217958
nsv1078878 OTHER inversion 25765185
nsv464239 CNV loss 19166990
nsv527119 CNV loss 19592680
nsv548132 CNV loss 21841781

Variation tolerance for ADCY10 Gene

Residual Variation Intolerance Score: 76.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.40; 71.13% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ADCY10 Gene

Human Gene Mutation Database (HGMD)
ADCY10
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ADCY10

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ADCY10 Gene

Disorders for ADCY10 Gene

MalaCards: The human disease database

(16) MalaCards diseases for ADCY10 Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards

UniProtKB/Swiss-Prot

ADCYA_HUMAN
  • Hypercalciuria absorptive 2 (HCA2) [MIM:143870]: A common type of hypercalciuria, a condition characterized by excessive urinary calcium excretion. Absorptive hypercalciuria is due to gastrointestinal hyperabsorption of calcium and is a frequent cause of calcium oxalate nephrolithiasis. {ECO:0000269 PubMed:11932268}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.

Additional Disease Information for ADCY10

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with ADCY10: view

No data available for Genatlas for ADCY10 Gene

Publications for ADCY10 Gene

  1. Soluble adenylyl cyclase is localized to cilia and contributes to ciliary beat frequency regulation via production of cAMP. (PMID: 17591988) Schmid A … Salathe M (The Journal of general physiology 2007) 3 4 23 56
  2. Kinetic properties of "soluble" adenylyl cyclase. Synergism between calcium and bicarbonate. (PMID: 12609998) Litvin TN … Levin LR (The Journal of biological chemistry 2003) 3 4 23 56
  3. Crystal structures of human soluble adenylyl cyclase reveal mechanisms of catalysis and of its activation through bicarbonate. (PMID: 24567411) Kleinboelting S … Steegborn C (Proceedings of the National Academy of Sciences of the United States of America 2014) 3 4 56
  4. Structural analysis of human soluble adenylyl cyclase and crystal structures of its nucleotide complexes-implications for cyclase catalysis and evolution. (PMID: 25040695) Kleinboelting S … Steegborn C (The FEBS journal 2014) 3 4 56
  5. Type 10 soluble adenylyl cyclase is overexpressed in prostate carcinoma and controls proliferation of prostate cancer cells. (PMID: 23255611) Flacke JP … Ladilov Y (The Journal of biological chemistry 2013) 2 3 56

Products for ADCY10 Gene

Sources for ADCY10 Gene