Free for academic non-profit institutions. Other users need a Commercial license
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene.
Diseases associated with ACE2 include Covid-19 and Severe Acute Respiratory Syndrome.
Among its related pathways are Collagen chain trimerization and Peptide hormone metabolism.
Gene Ontology (GO) annotations related to this gene include metallopeptidase activity and peptide binding.
An important paralog of this gene is ACE. See more...
Aliases for ACE2 Gene
Aliases for ACE2 Gene
External Ids for ACE2 Gene
- HGNC: 13557
- Entrez Gene: 59272
- Ensembl: ENSG00000130234
- OMIM: 300335
- UniProtKB: Q9BYF1
Previous GeneCards Identifiers for ACE2 Gene
- GC0XM015289
- GC0XM014404
- GC0XM014781
- GC0XM014940
- GC0XM015338
- GC0XM015489
- GC0XM013333
- GC0XM015579
- GC0XM015494
Summaries for ACE2 Gene
-
The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronavirus HCoV-NL63 and the human severe acute respiratory syndrome coronaviruses, SARS-CoV and SARS-CoV-2 (COVID-19 virus). [provided by RefSeq, Mar 2020]
GeneCards Summary for ACE2 Gene
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Covid-19 and Severe Acute Respiratory Syndrome. Among its related pathways are Collagen chain trimerization and Peptide hormone metabolism. Gene Ontology (GO) annotations related to this gene include metallopeptidase activity and peptide binding. An important paralog of this gene is ACE.
UniProtKB/Swiss-Prot Summary for ACE2 Gene
-
Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to angiotensin 1-9, a nine-amino acid peptide with anti-hypertrophic effects in cardiomyocytes, and angiotensin II to angiotensin 1-7, which then acts as a beneficial vasodilator and anti-proliferation agent, counterbalancing the actions of the vasoconstrictor angiotensin II (PubMed:10969042, PubMed:10924499, PubMed:11815627, PubMed:19021774, PubMed:14504186). Also removes the C-terminal residue from three other vasoactive peptides, neurotensin, kinetensin, and des-Arg bradykinin, but is not active on bradykinin (PubMed:10969042, PubMed:11815627). Also cleaves other biological peptides, such as apelins (apelin-13, [Pyr1]apelin-13, apelin-17, apelin-36), casomorphins (beta-casomorphin-7, neocasomorphin) and dynorphin A with high efficiency (PubMed:11815627, PubMed:27217402, PubMed:28293165). In addition, ACE2 C-terminus is homologous to collectrin and is responsible for the trafficking of the neutral amino acid transporter SL6A19 to the plasma membrane of gut epithelial cells via direct interaction, regulating its expression on the cell surface and its catalytic activity (PubMed:18424768, PubMed:19185582).
-
(Microbial infection) Acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63.
-
Angiotensin-converting enzyme (ACE, aka peptidyl dipeptidase A, carboxycathepsin) cleaves a C-terminal dipeptide from angiotensin I to create the vasoconstrictor peptide, angiotensin II. ACE can also inactivate the vasodilator, proinflammatory peptide, bradykinin.
Additional gene information for ACE2 Gene
- HGNC(13557)
- Entrez Gene(59272)
- Ensembl(ENSG00000130234)
- OMIM(300335)
- UniProtKB(Q9BYF1)
- Open Targets Platform(ENSG00000130234)
- Monarch Initiative
- Search for ACE2 at DataMed
- Search for ACE2 at HumanCyc
No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ACE2 Gene
Genomics for ACE2 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for ACE2 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around ACE2 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ACE2
- Top Transcription factor binding sites by QIAGEN in the ACE2 gene promoter:
-
- AP-1
- c-Fos
- c-Jun
- FOXO1
- FOXO1a
- GATA-1
- IRF-2
- MRF-2
- Nkx2-5
- YY1
Genomic Locations for ACE2 Gene
Genomic Locations for ACE2 Gene
- chrX:15,561,033-15,602,158
- (GRCh38/hg38)
- Size:
- 41,126 bases
- Orientation:
- Minus strand
- chrX:15,579,156-15,620,271
- (GRCh37/hg19)
- Size:
- 41,116 bases
- Orientation:
- Minus strand
Genomic View for ACE2 Gene
Genes around ACE2 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- Xp22.2 by HGNC
- Xp22.2 by Entrez Gene
- Xp22.2 by Ensembl
ACE2 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ACE2 Gene
Proteins for ACE2 Gene
-
Protein details for ACE2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9BYF1-ACE2_HUMAN
- Recommended name:
- Angiotensin-converting enzyme 2
- Protein Accession:
- Q9BYF1
- C7ECU1
- Q6UWP0
- Q86WT0
- Q9NRA7
- Q9UFZ6
Protein attributes for ACE2 Gene
- Size:
- 805 amino acids
- Molecular mass:
- 92463 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Cofactor:
- Name=chloride; Xref=ChEBI:CHEBI:17996;
- Quaternary structure:
-
- Homodimer (PubMed:32132184). Interacts with ITGB1 (PubMed:15276642). Interacts with the catalytically active form of TMPRSS2 (PubMed:21068237). Interacts with SLC6A19; this interaction is essential for expression and function of SLC6A19 in intestine (By similarity).
- (Microbial infection) Interacts with SARS coronavirus/SARS-CoV spike protein.
- (Microbial infection) Interacts with SARS coronavirus-2/SARS-CoV-2 spike protein.
- (Microbial infection) Interacts with human coronavirus NL63/HCoV-NL63 spike glycoprotein.
Three dimensional structures from OCA and Proteopedia for ACE2 Gene
Protein Expression for ACE2 Gene
Selected DME Specific Peptides for ACE2 Gene
- Q9BYF1:
-
- PWTLALE
- PHDETYCDPA
- FLTAHHEMGHIQYDMAYA
- ETEINFLLKQALTIVGTLPFTYMLEKWRWMVF
- DQSIKVRISLKSALG
- YFEPLFTWLK
- LLRNGANEGFHEAVGEIMSLSAATP
- VCHPTAWDLGKGDFRI
- GCLPAHLLGDMWGRFWTNLY
- WLLLSLVAV
- MSTIYSTGK
- DNSLEFLGI
- DYGDYWRGDYE
- QKPNIDVTDAM
- YPSYISP
- KWWEMKR
- NPQECLLLEPGL
- SFNFFVT
- ASWNYNTNIT
Post-translational modifications for ACE2 Gene
- N-glycosylation on Asn-90 may limit SARS infectivity.
- Proteolytic cleavage by ADAM17 generates a secreted form (PubMed:15983030). Also cleaved by serine proteases: TMPRSS2, TMPRSS11D and HPN/TMPRSS1.
-
Glycosylation at Asn53, Asn90, Asn103, Asn322, Asn432, Asn546, and Asn690
- NX_Q9BYF1 (NX_Q9BYF1-1)
- Modification sites at PhosphoSitePlus
-
Glycosylation from GlyConnect
- ACE2_HUMAN (1012)
Other Protein References for ACE2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- LifeSpan BioSciences ACE2 / ACE-2 Antibody (LS-B3197) and ACE2 / ACE-2 Antibody (LS-B6672)
- G Biosciences Immunotag™ ACE2 Antibody
- NSJ Bioreagents Angiotensin-Converting Enzyme 2 Antibody (ACE2)
-
Custom Antibody ServicesOriGene Antibodies for ACE2
- AM33487PU-N
- AP05885PU-N
- AP07652PU-N
- AP13058PU-N
- AP13060PU-N
- AP13062PU-N
- AP20785PU-N
- AP22661PU-N
- AP22858PU-N
- BP2277
- CF803841
- CF803842
- CF803844
- CF803845
- CF803906
- CF804152
- TA306146
- TA306147
- TA306148
- TA306149
- TA322220
- TA322221
- TA322222
- TA325141
- TA328186
- TA347899
- TA803841
- TA803841S
- TA803842
- TA803842S
- TA803844
- TA803844S
- TA803845
- TA803845S
- TA803906
- TA803906S
- TA804152
- TA804152S
- Novus Biologicals Antibodies for ACE2
-
Abcam antibodies for ACE2
- Invitrogen Antibodies for ACE2 (AFLGC-ACE2)
-
Custom Antibody ServicesProSci Antibodies for ACE2
-
Santa Cruz Biotechnology (SCBT) Antibodies for ACE2
- Sino Biological Antibodies for ACE2
Protein Products
- G Biosciences Human ACE-2, Liquid
-
OriGene Purified Proteins for ACE2
- Search Origene for MassSpec and Protein Over-expression Lysates for ACE2
- Origene Custom Protein Services for ACE2
- Novus Biologicals proteins for ACE2
- Sino Biological Recombinant Proteins for ACE2
- Sino Biological Cell Lysates for ACE2
-
ProSci Proteins for ACE2
-
Abcam proteins for ACE2
Assay Products
- Aviva Systems Biology ACE2 ELISA Kit (Human) (OKBB00649), ACE2 ELISA Kit (Human) : 96 Wells (OKEH02626), and ACE2 ELISA Kit (Human) (OKCD07767)
- Novus Biologicals ELISA Kits for ACE2
- antibodies-online: Show 74 available Angiotensin I Converting Enzyme 2 Elisa Kits ranked by validation data
- Compare Top Angiotensin I Converting Enzyme 2 Elisa Kits
-
Quality Products:
- ABIN1113408
- ABIN1672892
- ABIN415147
- ABIN5523959
- ABIN2708063
- ABIN6720210
- ABIN5669250
- ABIN1568114
- ABIN5594199
- ABIN512827
- ABIN1889360
- ABIN425168
- ABIN2708416
- ABIN627486
- ABIN832277
- ABIN1568115
- ABIN5651788
- ABIN6720239
- ABIN2541346
- ABIN6226205
- ABIN431519
- ABIN585357
- ABIN578380
- ABIN1568116
- ABIN5523960
- ABIN5519261
- ABIN626655
- ABIN5594200
- ABIN5651789
- ABIN2541347
- ABIN774123
- ABIN1558950
- ABIN6226211
-
Abcam assays for ACE2
- Sino Biological Assays for ACE2
Domains & Families for ACE2 Gene
Gene Families for ACE2 Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- FDA approved drug targets
- Predicted membrane proteins
- Predicted secreted proteins
Protein Domains for ACE2 Gene
- InterPro:
- Blocks:
-
- Peptidyl-dipeptidase A (M2) metalloprotease family signature
- ProtoNet:
Suggested Antigen Peptide Sequences for ACE2 Gene
- GenScript: Design optimal peptide antigens:
-
- Metalloprotease MPROT15 (ACE2_HUMAN)
- Angiotensin I converting enzyme 2 (C7ECU1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9BYF1UniProtKB/Swiss-Prot:
ACE2_HUMAN :- The extracellular region of the ACE2 enzyme is composed of two domains. The first is a zinc metallopeptidase domain (residues 19-611). The second domain is located at the C-terminus (residues 612-740) and is 48% identical to human collectrin.
- Belongs to the peptidase M2 family.
- Domain:
-
- The extracellular region of the ACE2 enzyme is composed of two domains. The first is a zinc metallopeptidase domain (residues 19-611). The second domain is located at the C-terminus (residues 612-740) and is 48% identical to human collectrin.
- Family:
-
- Belongs to the peptidase M2 family.
Function for ACE2 Gene
Molecular function for ACE2 Gene
- UniProtKB/Swiss-Prot Function:
- Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to angiotensin 1-9, a nine-amino acid peptide with anti-hypertrophic effects in cardiomyocytes, and angiotensin II to angiotensin 1-7, which then acts as a beneficial vasodilator and anti-proliferation agent, counterbalancing the actions of the vasoconstrictor angiotensin II (PubMed:10969042, PubMed:10924499, PubMed:11815627, PubMed:19021774, PubMed:14504186). Also removes the C-terminal residue from three other vasoactive peptides, neurotensin, kinetensin, and des-Arg bradykinin, but is not active on bradykinin (PubMed:10969042, PubMed:11815627). Also cleaves other biological peptides, such as apelins (apelin-13, [Pyr1]apelin-13, apelin-17, apelin-36), casomorphins (beta-casomorphin-7, neocasomorphin) and dynorphin A with high efficiency (PubMed:11815627, PubMed:27217402, PubMed:28293165). In addition, ACE2 C-terminus is homologous to collectrin and is responsible for the trafficking of the neutral amino acid transporter SL6A19 to the plasma membrane of gut epithelial cells via direct interaction, regulating its expression on the cell surface and its catalytic activity (PubMed:18424768, PubMed:19185582).
- UniProtKB/Swiss-Prot Function:
- (Microbial infection) Acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=angiotensin II + H2O = angiotensin-(1-7) + L-phenylalanine; Xref=Rhea:RHEA:26554, ChEBI:CHEBI:15377, ChEBI:CHEBI:58095, ChEBI:CHEBI:58506, ChEBI:CHEBI:58922; EC=3.4.17.23; Evidence={ECO:0000269|PubMed:10924499, ECO:0000269|PubMed:11815627, ECO:0000269|PubMed:19021774, ECO:0000305|PubMed:14504186};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=angiotensin I + H2O = angiotensin-(1-9) + L-leucine; Xref=Rhea:RHEA:63532, ChEBI:CHEBI:15377, ChEBI:CHEBI:57427, ChEBI:CHEBI:147350, ChEBI:CHEBI:147351; Evidence={ECO:0000269|PubMed:10924499, ECO:0000269|PubMed:10969042, ECO:0000269|PubMed:11815627, ECO:0000269|PubMed:19021774};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=[des-Arg(9)]-bradykinin + H2O = [des-Phe(8), des-Arg(9)]-bradykinin + L-phenylalanine; Xref=Rhea:RHEA:63536, ChEBI:CHEBI:15377, ChEBI:CHEBI:58095, ChEBI:CHEBI:133069, ChEBI:CHEBI:147352; Evidence={ECO:0000269|PubMed:10969042, ECO:0000269|PubMed:11815627};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + neurotensin = L-leucine + neurotensin-(1-12); Xref=Rhea:RHEA:63540, ChEBI:CHEBI:15377, ChEBI:CHEBI:57427, ChEBI:CHEBI:147362, ChEBI:CHEBI:147363; Evidence={ECO:0000269|PubMed:10969042};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + neurotensin-(1-8) = L-arginine + neurotensin-(1-7); Xref=Rhea:RHEA:63572, ChEBI:CHEBI:15377, ChEBI:CHEBI:32682, ChEBI:CHEBI:147393, ChEBI:CHEBI:147394; Evidence={ECO:0000269|PubMed:11815627};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + kinetensin = kinetensin-(1-8) + L-leucine; Xref=Rhea:RHEA:63544, ChEBI:CHEBI:15377, ChEBI:CHEBI:57427, ChEBI:CHEBI:147364, ChEBI:CHEBI:147365; Evidence={ECO:0000269|PubMed:10969042};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=dynorphin A-(1-13) + H2O = dynorphin A-(1-12) + L-lysine; Xref=Rhea:RHEA:63556, ChEBI:CHEBI:15377, ChEBI:CHEBI:32551, ChEBI:CHEBI:147381, ChEBI:CHEBI:147383; Evidence={ECO:0000269|PubMed:11815627};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=apelin-13 + H2O = apelin-12 + L-phenylalanine; Xref=Rhea:RHEA:63564, ChEBI:CHEBI:15377, ChEBI:CHEBI:58095, ChEBI:CHEBI:147395, ChEBI:CHEBI:147396; Evidence={ECO:0000269|PubMed:11815627};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=[Pyr1]apelin-13 + H2O = [Pyr1]apelin-12 + L-phenylalanine; Xref=Rhea:RHEA:63604, ChEBI:CHEBI:15377, ChEBI:CHEBI:58095, ChEBI:CHEBI:147415, ChEBI:CHEBI:147416; Evidence={ECO:0000269|PubMed:27217402, ECO:0000269|PubMed:28293165};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=apelin-17 + H2O = apelin-16 + L-phenylalanine; Xref=Rhea:RHEA:63608, ChEBI:CHEBI:15377, ChEBI:CHEBI:58095, ChEBI:CHEBI:147421, ChEBI:CHEBI:147422; Evidence={ECO:0000269|PubMed:27217402};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=beta-casomorphin-7 + H2O = beta-casomorphin-6 + L-isoleucine; Xref=Rhea:RHEA:63568, ChEBI:CHEBI:15377, ChEBI:CHEBI:58045, ChEBI:CHEBI:147390, ChEBI:CHEBI:147391; Evidence={ECO:0000269|PubMed:11815627};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + neocasomorphin = L-isoleucine + neocasomorphin-(1-5); Xref=Rhea:RHEA:63600, ChEBI:CHEBI:15377, ChEBI:CHEBI:58045, ChEBI:CHEBI:147417, ChEBI:CHEBI:147418; Evidence={ECO:0000269|PubMed:11815627};.
- UniProtKB/Swiss-Prot Induction:
- Up-regulated in failing heart.
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=6.9 uM for angiotensin I {ECO:0000269|PubMed:11815627}; KM=2.0 uM for angiotensin II {ECO:0000269|PubMed:11815627}; KM=6.8 uM for apelin-13 {ECO:0000269|PubMed:11815627}; KM=290 uM for [des-Arg(9)]-bradykinin {ECO:0000269|PubMed:11815627}; KM=130 uM for Lys-[des-Arg(9)]-bradykinin {ECO:0000269|PubMed:11815627}; KM=31 uM for beta-casomorphin {ECO:0000269|PubMed:11815627}; KM=5.5 uM for dynorphin A-(1-13) {ECO:0000269|PubMed:11815627}; KM=300 uM for neurotensin-(1-8) {ECO:0000269|PubMed:11815627}; KM=58.6 uM for angiotensin II {ECO:0000269|PubMed:19021774}; KM=12 uM for [Pyr1]apelin-13 {ECO:0000269|PubMed:27217402}; KM=19 uM for apelin-17 {ECO:0000269|PubMed:27217402}; Vmax=28.7 nmol/min/mg enzyme with angiotensin II as substrate {ECO:0000269|PubMed:19021774}; Note=kcat is 0.034 sec(-1) with angiotensin I as substrate. kcat is 3.5 sec(-1) with angiotensin II as substrate. kcat is 13 sec(-1) with apelin-13 as substrate. kcat is 62 sec(-1) with [des-Arg(9)]-bradykinin as substrate. kcat is 26 sec(-1) with Lys-[des-Arg(9)]-bradykinin as substrate. kcat is 6.8 sec(-1) with beta-casomorphin as substrate. kcat is 16 sec(-1) with dynorphin A-(1-13) as substrate. kcat is 57 sec(-1) with neurotensin-(1-8) as substrate (PubMed:11815627). kcat is 19.1 sec(-1) with [Pyr1]apelin-13 as substrate. kcat is 7.7 sec(-1) with apelin-17 as substrate (PubMed:27217402). {ECO:0000269|PubMed:11815627, ECO:0000269|PubMed:27217402}; pH dependence: Optimum pH is 6.5 in the presence of 1 M NaCl. Active from pH 6 to 9. {ECO:0000269|PubMed:11815627};
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Regulated by chloride and fluoride, but not bromide (PubMed:11815627). Chloride increases angiotensin I and decreases angiotensin II cleavage (PubMed:19021774). Inhibited by MLN-4760, cFP_Leu, and EDTA (PubMed:15231706, PubMed:10924499), but not by the ACE inhibitors lisinopril, captopril and enalaprilat (PubMed:10969042, PubMed:10924499). Highly potent and selective in vitro ACE2 inhibitors were identified (PubMed:12358520).
Enzyme Numbers (IUBMB) for ACE2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001618 | virus receptor activity | IDA,IMP | 24227843 |
| GO:0004175 | endopeptidase activity | IDA | 15283675 |
| GO:0004180 | carboxypeptidase activity | IEA,IDA | 10924499 |
| GO:0004181 | metallocarboxypeptidase activity | EXP | 10924499 |
| GO:0005515 | protein binding | IPI | 10969042 |
Phenotypes for ACE2 Gene
- MGI mutant phenotypes for ACE2:
-
inferred from 6 alleles
- immune system phenotype
- respiratory system phenotype
- cardiovascular system phenotype
- cellular phenotype
- mortality/aging
- muscle phenotype
- homeostasis/metabolism phenotype
- growth/size/body region phenotype
- renal/urinary system phenotype
- digestive/alimentary phenotype
- integument phenotype
- pigmentation phenotype
- GenomeRNAi human phenotypes for ACE2:
-
- Decreased hepcidin::fluc mRNA expression
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- no effect
- Decreased viability
- Synthetic lethal with Ras
- Decreased Salmonella enterica Typhimurium invasion
- Decreased viability in glioblastoma multiforme (GBM) lineage
- Decreased epidermal growth factor (EGF) endocytosis
Animal Models for ACE2 Gene
Animal Model Products
-
Taconic Biosciences Mouse Models for ACE2
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ACE2 - Select products 50% OFF >
- * ACE2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for ACE2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ACE2
-
Santa Cruz Biotechnology (SCBT) CRISPR for ACE2
miRNA for ACE2 Gene
- miRTarBase miRNAs that target ACE2
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ACE2
- Browse OriGene Inhibitory RNA Products For ACE2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ACE2
Clone Products
- Applied Biological Materials (abm): Clones for ACE2 - Select products 50% OFF >
- * ACE2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for ACE2
- Addgene plasmids for ACE2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ACE2
Cell Line Products
-
Horizon Cell Lines for ACE2
No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ACE2 Gene
Localization for ACE2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ACE2 Gene
- [Processed angiotensin-converting enzyme 2]: Secreted.
- Cell membrane. Single-pass type I membrane protein. Cytoplasm. Note=Detected in both cell membrane and cytoplasm in neurons. {ECO:0000250 UniProtKB:Q8R0I0}.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| extracellular | 5 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| peroxisome | 2 |
| nucleus | 2 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| cytosol | 2 |
| lysosome | 2 |
| golgi apparatus | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005576 | extracellular region | IEA,IDA | 10969042 |
| GO:0005615 | extracellular space | IBA,IDA | 18258853 |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005886 | plasma membrane | TAS | -- |
| GO:0009986 | cell surface | IDA | 18343844 |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for ACE2 Gene
Pathways & Interactions for ACE2 Gene
Pathways by source for ACE2 Gene
1 BioSystems pathway for ACE2 Gene
3 Reactome pathways for ACE2 Gene
2 PharmGKB pathways for ACE2 Gene
2 KEGG pathways for ACE2 Gene
2 R&D Systems pathways for ACE2 Gene
Interacting Proteins for ACE2 Gene
Selected Interacting proteins:
Q9BYF1-ACE2_HUMAN
ENSP00000389326
for ACE2 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for ACE2
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001817 | regulation of cytokine production | IC | 15380922 |
| GO:0002003 | angiotensin maturation | IC,TAS | -- |
| GO:0003051 | angiotensin-mediated drinking behavior | IMP | 18258853 |
| GO:0003081 | regulation of systemic arterial blood pressure by renin-angiotensin | IMP | 18258853 |
| GO:0006508 | proteolysis | IEA | -- |
Drugs & Compounds for ACE2 Gene
(54) Drugs for ACE2 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Captopril | Approved | Pharma | Inhibitor, Inhibition | ACE inhibitor, ACE inhibitor; also inhibits LTA4 hydrolase | 50 | |
| Hydroxychloroquine | Approved | Pharma | Target, modulator | Autophagy inhibitor | 431 | |
| Angiotensin II | Approved, Investigational | Pharma | Agonist, Full agonist | Potent vasopressor and a powerful stimulus for production and release of aldosterone from the adrenal cortex. | 1347 | |
| Vitamin C | Approved | Nutra | 748,748 | |||
| Lisinopril | Approved, Investigational | Pharma | inhibitor | ACE inhibitor | 131 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Benazepril hydrochloride |
|
86541-74-4 |
|
|
||
| Moexipril hydrochloride |
|
82586-52-5 |
|
|
(5) Tocris Compounds for ACE2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| Benazepril hydrochloride | Angiotensin-converting enzyme (ACE) inhibitor | 86541-74-4 |
| Captopril | ACE inhibitor; also inhibits LTA4 hydrolase | 62571-86-2 |
| Moexipril hydrochloride | Angiotensin-converting enzyme (ACE) inhibitor | 82586-52-5 |
| Perindopril erbumine | Angiotensin-converting enzyme (ACE) inhibitor | 107133-36-8 |
| Spinorphin | Enkephalin-degrading and ACE inhibitor | 137201-62-8 |
(6) ApexBio Compounds for ACE2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| Acetyl Angiotensinogen (1-14), porcine | Angiotensinogen precursor | 66641-26-7 |
| Angiotensin 1/2 (1-5) | Vasoconstrictor | 58442-64-1 |
| Angiotensin 1/2 + A (2 - 8) | 51833-76-2 | |
| Angiotensin I (human, mouse, rat) | Precursor of angiotensin II | 484-42-4 |
| Enalaprilat Dihydrate | 84680-54-6 | |
| Ramipril | 87333-19-5 |
Transcripts for ACE2 Gene
mRNA/cDNA for ACE2 Gene
- 2 REFSEQ mRNAs :
- 16 NCBI additional mRNA sequence :
- 5 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000252519 3339 nts (view in UCSC)
- ENST00000427411 3507 nts (view in UCSC)
- ENST00000471548 998 nts (view in UCSC)
- ENST00000473851 786 nts (view in UCSC)
- ENST00000484756 599 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ACE2 - Select products 50% OFF >
- * ACE2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for ACE2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ACE2
-
Santa Cruz Biotechnology (SCBT) CRISPR for ACE2
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ACE2
- Browse OriGene Inhibitory RNA Products For ACE2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ACE2
Clone Products
- Applied Biological Materials (abm): Clones for ACE2 - Select products 50% OFF >
- * ACE2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for ACE2
- Addgene plasmids for ACE2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ACE2
| ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | · | 2c | ^ | 3 | ^ | 4a | · | 4b | · | 4c | ^ | 5a | · | 5b | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - |
| ExUns: | 17b | ^ | 18 | ^ | 19 | ^ | 20 |
|---|---|---|---|---|---|---|---|
| SP1: | |||||||
| SP2: | |||||||
| SP3: | |||||||
| SP4: | |||||||
| SP5: | |||||||
| SP6: |
Relevant External Links for ACE2 Gene
- GeneLoc Exon Structure for
- ACE2
Expression for ACE2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Kidney (Urinary System)
- Loop of Henle Cells Loop of Henle
- Presumptive Podocytes Podocyte Layer
- Medullary Stroma Cells Interstitial Stroma
- Loop of Henle
- Interstitial Stroma
-
Testis (Reproductive System)
- Leydig Cells Testis Interstitium
- Testicular Interstitial Cells Testis Interstitium
- XY Germ Cells Testis Cord
- Testis Interstitium
-
Epithelial Cells
- Fetal Matrix Cells Hair Follicle
- Loop of Henle Cells Loop of Henle
- Presumptive Podocytes Podocyte Layer
-
Ovary (Reproductive System)
- Cumulus Cells Antral Follicle
- Ovarian Mesenchymal Stroma Cells Ovary Interstitium
-
Hair (Integumentary System)
- Fetal Matrix Cells Hair Follicle
-
Gonad
- XY Germ Cells Testis Cord
-
Brain (Nervous System)
- Adult Endothelial Cells Blood Brain Barrier
-
Endothelium (Cardiovascular System)
- Adult Endothelial Cells Blood Brain Barrier
- Intermediate Mesoderm (Gastrulation Derivatives)
- Lower Urinary Tract (Urinary System)
- Intestine (Gastrointestinal Tract)
-
Gall Bladder (Hepatobiliary System)
-
Epidermis (Integumentary System)
mRNA differential expression in normal tissues according to GTEx for ACE2 Gene
This gene is overexpressed in Small Intestine - Terminal Ileum (x13.3), Testis (x7.7), and Heart - Left Ventricle (x6.6).
This gene is overexpressed in Ovary (30.4), Urine (19.6), and Pancreatic juice (14.2).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for ACE2 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ACE2
SOURCE GeneReport for Unigene cluster for ACE2 Gene:
Hs.178098mRNA Expression by UniProt/SwissProt for ACE2 Gene:
Q9BYF1-ACE2_HUMAN
Tissue specificity:
Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells (at protein level) (PubMed:15141377). Expressed in lung alveolar epithelial cells, enterocytes of the small intestine, Leydig cells and Sertoli cells (at protein level) (PubMed:15141377). Expressed in the renal proximal tubule and the small intestine (at protein level) (PubMed:18424768). Expressed in heart, kidney, testis, and gastrointestinal system (PubMed:10969042, PubMed:10924499, PubMed:15231706, PubMed:12459472, PubMed:15671045).
Evidence on tissue expression from TISSUES for ACE2 Gene
- Heart(4.7)
- Lung(4.6)
- Nervous system(4.5)
- Liver(4.5)
- Kidney(3.8)
- Muscle(3.3)
- Blood(3)
- Gall bladder(2.7)
- Intestine(2.7)
- Urine(2.2)
- Pancreas(2.2)
- Adrenal gland(2.2)
- Skin(2.1)
- Stomach(2)
Primer Products
-
OriGene qPCR primer pairs for ACE2
-
OriGene qPCR primer pairs and template standards for ACE2
Gene Expression Assay Products
No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ACE2 Gene
Orthologs for ACE2 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | ACE2 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | ACE2 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | ACE2 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Ace2 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Ace2 30 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | ACE2 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | ACE2 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | ACE2 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | ACE2 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | ace2 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | ace2 30 31 |
|
OneToOne | |
| Rainbow Trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.2478 30 |
|
||
| Fruit Fly (Drosophila melanogaster) |
Insecta | Ance 31 |
|
ManyToMany | |
| Acer 31 32 |
|
ManyToMany | |||
| Ance-2 32 |
|
|
|||
| Worm (Caenorhabditis elegans) |
Secernentea | acn-1 30 31 |
|
OneToMany | |
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
ManyToMany |
- Species where no ortholog for ACE2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for ACE2 Gene
- ENSEMBL:
- Gene Tree for ACE2 (if available)
- TreeFam:
- Gene Tree for ACE2 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for ACE2: view image
Paralogs for ACE2 Gene
Variants for ACE2 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ACE2 Gene
| SNP ID | Clinical significance and condition | Chr 0X pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 724557 | Likely Benign: not provided | 15,589,463(-) | G/T | INTRON_VARIANT | |
| 778980 | Benign: not provided | 15,566,297(-) | A/G | SYNONYMOUS_VARIANT | |
| 780203 | Likely Benign: not provided | 15,600,835(-) | T/C | MISSENSE_VARIANT | |
| rs183135788 | - | p.Asn638Ser | |||
| rs4646116 | - | p.Lys26Arg |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv1125275 | CNV | insertion | 24896259 |
Residual Variation Intolerance Score:
49.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.61;
31.01% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ACE2 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ACE2 Gene
Disorders for ACE2 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| covid-19 |
|
|
| severe acute respiratory syndrome |
|
|
| coronavirus infectious disease |
|
|
| hartnup disorder |
|
|
| intracranial aneurysm |
|
Search ACE2 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for ACE2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for ACE2 Gene
Publications for ACE2 Gene
- A novel angiotensin-converting enzyme-related carboxypeptidase (ACE2) converts angiotensin I to angiotensin 1-9. (PMID: 10969042) Donoghue M … Acton S (Circulation research 2000) 2 3 4 23
- Tissue-specific amino acid transporter partners ACE2 and collectrin differentially interact with hartnup mutations. (PMID: 19185582) Camargo SM … Verrey F (Gastroenterology 2009) 3 4 23
- Polymorphisms of angiotensin-converting enzyme (ACE) and ACE2 are not associated with orthostatic blood pressure dysregulation in hypertensive patients. (PMID: 19684612) Fan XH … Hui RT (Acta pharmacologica Sinica 2009) 3 23 41
- Genetic variation in angiotensin-converting enzyme-related pathways associated with sudden cardiac arrest risk. (PMID: 19716087) Sotoodehnia N … Siscovick DS (Heart rhythm 2009) 3 23 41
- Residues affecting the chloride regulation and substrate selectivity of the angiotensin-converting enzymes (ACE and ACE2) identified by site-directed mutagenesis. (PMID: 19021774) Rushworth CA … Turner AJ (The FEBS journal 2008) 3 4 23
ExternalLinks
Products for ACE2 Gene
- View all 25 R&D Systems ACE2 (ACE-2) Products
- View all R&D Systems ACE2 (ACE-2) Proteins and Enzymes
- View all 21 R&D Systems ACE2 (ACE-2) Primary Antibodies
- View all R&D Systems ACE2 (ACE-2) ELISAs
- View all 2 R&D Systems ACE2 (ACE-2) cDNA Clones
- Learn more about R&D Systems custom ACE2 antibody, protein, and immunoassay development services
- Custom Antibody ServicesOriGene Antibodies for ACE2
- AM33487PU-N
- AP05885PU-N
- AP07652PU-N
- AP13058PU-N
- AP13060PU-N
- AP13062PU-N
- AP20785PU-N
- AP22661PU-N
- AP22858PU-N
- BP2277
- CF803841
- CF803842
- CF803844
- CF803845
- CF803906
- CF804152
- TA306146
- TA306147
- TA306148
- TA306149
- TA322220
- TA322221
- TA322222
- TA325141
- TA328186
- TA347899
- TA803841
- TA803841S
- TA803842
- TA803842S
- TA803844
- TA803844S
- TA803845
- TA803845S
- TA803906
- TA803906S
- TA804152
- TA804152S
- Custom Assay Services
- OriGene Purified Proteins for ACE2
- Search Origene for MassSpec and Protein Over-expression Lysates for ACE2
- Origene Custom Protein Services for ACE2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ACE2
- Browse OriGene Inhibitory RNA Products For ACE2
- OriGene qPCR primer pairs for ACE2
- OriGene qPCR primer pairs and template standards for ACE2
- OriGene CRISPR knockouts for ACE2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ACE2
- Sino Biological Human cDNA Clone for ACE2
- Sino Biological Recombinant Proteins for ACE2
- Sino Biological Cell Lysates for ACE2
- Sino Biological Antibodies for ACE2
- Sino Biological Assays for ACE2
- Browse Recombinant Proteins
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for ACE2
- Novus Biologicals proteins for ACE2
- Novus Biologicals ELISA Kits for ACE2
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for ACE2
- Abcam proteins for ACE2
- Abcam assays for ACE2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for ACE2
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for ACE2 (AFLGC-ACE2)
- ApexBio compounds for ACE2
- VectorBuilder Custom and pre-made DNA vectors for ACE2 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for ACE2 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for ACE2 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for ACE2 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for ACE2
- Addgene plasmids for ACE2
- antibodies-online: Show 83 available Angiotensin I Converting Enzyme 2 Antibodies ranked by validation data
- antibodies-online: Show 74 available Angiotensin I Converting Enzyme 2 Elisa Kits ranked by validation data
- Compare Top Angiotensin I Converting Enzyme 2 Elisa Kits
- Quality Products:
- ABIN1113408
- ABIN1672892
- ABIN415147
- ABIN5523959
- ABIN2708063
- ABIN6720210
- ABIN5669250
- ABIN1568114
- ABIN5594199
- ABIN512827
- ABIN1889360
- ABIN425168
- ABIN2708416
- ABIN627486
- ABIN832277
- ABIN1568115
- ABIN5651788
- ABIN6720239
- ABIN2541346
- ABIN6226205
- ABIN431519
- ABIN585357
- ABIN578380
- ABIN1568116
- ABIN5523960
- ABIN5519261
- ABIN626655
- ABIN5594200
- ABIN5651789
- ABIN2541347
- ABIN774123
- ABIN1558950
- ABIN6226211
- antibodies-online: Show 24 available Angiotensin I Converting Enzyme 2 Proteins ranked by validation data
- Compare Top Angiotensin I Converting Enzyme 2 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for ACE2
- Search Santa Cruz Biotechnology (SCBT) for ACE2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ACE2
- Custom Antibody ServicesProSci Antibodies for ACE2
- ProSci Proteins for ACE2
- Horizon Cell Lines for ACE2
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ACE2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ACE2
- Search GeneCopoeia for miRNA 3'UTR Target clone products for ACE2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ACE2
Sources for ACE2 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB