This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 domain, whereby deletion of the region encoding this domain results in an oncogene. The ubiquitously expressed protein has DNA-b... See more...

Aliases for ABL1 Gene

Aliases for ABL1 Gene

  • ABL Proto-Oncogene 1, Non-Receptor Tyrosine Kinase 2 3 5
  • V-Abl Abelson Murine Leukemia Viral Oncogene Homolog 1 2 3
  • C-Abl Oncogene 1, Receptor Tyrosine Kinase 2 3
  • Abelson Tyrosine-Protein Kinase 1 3 4
  • Tyrosine-Protein Kinase ABL1 3 4
  • Proto-Oncogene C-Abl 3 4
  • EC 2.7.10.2 4 54
  • JTK7 3 4
  • P150 3 4
  • ABL 3 4
  • Truncated ABL Protooncogene 1 Nonreceptor Tyrosine Kinase 3
  • Abelson Murine Leukemia Viral Oncogene Homolog 1 4
  • ABL Protooncogene 1 Nonreceptor Tyrosine Kinase 3
  • C-Abl Oncogene 1, Non-Receptor Tyrosine Kinase 2
  • Proto-Oncogene Tyrosine-Protein Kinase ABL1 3
  • Bcr/C-Abl Oncogene Protein 3
  • Tyrosine-Protein Kinase 3
  • EC 2.7.10 54
  • BCR-ABL 3
  • Bcr/Abl 3
  • CHDSKM 3
  • C-ABL1 3
  • C-ABL 3
  • V-Abl 3

External Ids for ABL1 Gene

Previous HGNC Symbols for ABL1 Gene

  • ABL

Previous GeneCards Identifiers for ABL1 Gene

  • GC09P124604
  • GC09P125136
  • GC09P126943
  • GC09P128865
  • GC09P130619
  • GC09P132579
  • GC09P133589
  • GC09P103075

Summaries for ABL1 Gene

Entrez Gene Summary for ABL1 Gene

  • This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 domain, whereby deletion of the region encoding this domain results in an oncogene. The ubiquitously expressed protein has DNA-binding activity that is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function. This gene has been found fused to a variety of translocation partner genes in various leukemias, most notably the t(9;22) translocation that results in a fusion with the 5' end of the breakpoint cluster region gene (BCR; MIM:151410). Alternative splicing of this gene results in two transcript variants, which contain alternative first exons that are spliced to the remaining common exons. [provided by RefSeq, Aug 2014]

CIViC Summary for ABL1 Gene

  • ABL1 is most relevant to cancer in its role in the BCR-ABL fusion protein that has become a signature of chronic myeloid leukemia (CML). Cells harboring this fusion have shown sensitivity to imatinib, greatly improving the prognostic outlook of the disease. However, additional mutations in ABL1 have been shown to confer resistance to imatinib. In these resistance cases, second-generation tyrosine kinase inhibitors such as dasatinib and nilotinib have exhibited some efficacy and are currently undergoing clinical trials for treating acquired resistance in CML.

GeneCards Summary for ABL1 Gene

ABL1 (ABL Proto-Oncogene 1, Non-Receptor Tyrosine Kinase) is a Protein Coding gene. Diseases associated with ABL1 include Leukemia, Chronic Myeloid and Congenital Heart Defects And Skeletal Malformations Syndrome. Among its related pathways are Signaling by Robo receptor and DNA Damage Response. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is ABL2.

UniProtKB/Swiss-Prot Summary for ABL1 Gene

  • Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. In response to oxidative stress, phosphorylates serine/threonine kinase PRKD2 at 'Tyr-717' (PubMed:28428613). ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner. Phosphorylates TBX21 on tyrosine residues leading to an enhancement of its transcriptional activator activity (By similarity).

Tocris Summary for ABL1 Gene

  • The Abl family of non-receptor tyrosine kinases includes c-Abl (Abelson tyrosine kinase) and Arg (Abl2) subtypes. c-Abl is localized at many subcellular sites including the nucleus, cytoplasm, mitochondria and endoplasmic reticulum, where it interacts with several proteins.

Gene Wiki entry for ABL1 Gene

PharmGKB "VIP" Summary for ABL1 Gene

Additional gene information for ABL1 Gene

No data available for Rfam classification and piRNA Summary for ABL1 Gene

Genomics for ABL1 Gene

GeneHancer (GH) Regulatory Elements for ABL1 Gene

Promoters and enhancers for ABL1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ABL1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the ABL1 gene promoter:
  • C/EBPbeta
  • GATA-3
  • MyoD
  • NF-1
  • STAT1
  • STAT3

Genomic Locations for ABL1 Gene

Genomic Locations for ABL1 Gene
chr9:130,713,881-130,887,675
(GRCh38/hg38)
Size:
173,795 bases
Orientation:
Plus strand
chr9:133,589,268-133,763,062
(GRCh37/hg19)
Size:
173,795 bases
Orientation:
Plus strand

Genomic View for ABL1 Gene

Genes around ABL1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ABL1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ABL1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ABL1 Gene

Proteins for ABL1 Gene

  • Protein details for ABL1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P00519-ABL1_HUMAN
    Recommended name:
    Tyrosine-protein kinase ABL1
    Protein Accession:
    P00519
    Secondary Accessions:
    • A3KFJ3
    • Q13869
    • Q13870
    • Q16133
    • Q17R61
    • Q45F09

    Protein attributes for ABL1 Gene

    Size:
    1130 amino acids
    Molecular mass:
    122873 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with SORBS1 following insulin stimulation. Found in a trimolecular complex containing CDK5 and CABLES1. Interacts with CABLES1 and PSTPIP1. Interacts with ZDHHC16, ITGB1 and HCK (By similarity). Interacts with STX17; probably phosphorylates STX17. Interacts with INPPL1/SHIP2. Interacts with the 14-3-3 proteins, YWHAB, YWHAE, YWHAG, YWHAH, SFN AND YWHAZ; the interaction with 14-3-3 proteins requires phosphorylation on Thr-735 and, sequesters ABL1 into the cytoplasm. Interacts with ABI1, ABI2, BCR, CRK, FGR, FYN, HCK, LYN, PSMA7 RAD9A, RAD51, RAD52, TP73 and WASF3. A complex made of ABL1, CTTN and MYLK regulates cortical actin-based cytoskeletal rearrangement critical to sphingosine 1-phosphate (S1P)-mediated endothelial cell (EC) barrier enhancement. Interacts (via SH3 domain) with CASP9; the interaction is direct and increases in the response of cells to genotoxic stress and ABL1/c-Abl activation. Found in a complex with ABL1, ABL2, CRK and UNC119; leading to the inhibition of CRK phosphorylation by ABL kinases. Interacts with TBX21 (By similarity).

    Three dimensional structures from OCA and Proteopedia for ABL1 Gene

    Alternative splice isoforms for ABL1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ABL1 Gene

Selected DME Specific Peptides for ABL1 Gene

P00519:
  • PLRRQVTV
  • LLYMATQI
  • RDLAARN
  • KLGGGQYG
  • KEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCT
  • HQAFETMF
  • LAYNKFS
  • KFPIKWTAPE
  • NSLEKHSWYHGP
  • RNKFAFREA
  • ELVHHHS
  • GVWKKYSLTVAVKT
  • YGNLLDYLREC
  • GVCTREPPFYIITEFM
  • TTLHYPAPK
  • INGSFLVRESESSPGQ
  • KVYELMRACW
  • LFVALYD
  • KSDVWAFGVLLWEIATYGM

Post-translational modifications for ABL1 Gene

  • Acetylated at Lys-711 by EP300 which promotes the cytoplasmic translocation.
  • Phosphorylation at Tyr-70 by members of the SRC family of kinases disrupts SH3 domain-based autoinhibitory interactions and intermolecular associations, such as that with ABI1, and also enhances kinase activity. Phosphorylation at Tyr-226 and Tyr-393 correlate with increased activity. DNA damage-induced activation of ABL1 requires the function of ATM and Ser-446 phosphorylation (By similarity). Phosphorylation at Ser-569 has been attributed to a CDC2-associated kinase and is coupled to cell division (By similarity). Phosphorylation at Ser-618 and Ser-619 by PAK2 increases binding to CRK and reduces binding to ABI1. Phosphorylation on Thr-735 is required for binding 14-3-3 proteins for cytoplasmic translocation. Phosphorylated by PRKDC (By similarity).
  • Polyubiquitinated. Polyubiquitination of ABL1 leads to degradation.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for ABL1 Gene

Antibody Products

Domains & Families for ABL1 Gene

Gene Families for ABL1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for ABL1 Gene

GenScript: Design optimal peptide antigens:
  • p150 (ABL1_HUMAN)
  • ABL1 protein (Q13689_HUMAN)
  • ABL1 protein (Q13691_HUMAN)
  • ABL1 protein (Q13914_HUMAN)
  • C-abl (Q13915_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P00519

UniProtKB/Swiss-Prot:

ABL1_HUMAN :
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
genes like me logo Genes that share domains with ABL1: view

Function for ABL1 Gene

Molecular function for ABL1 Gene

UniProtKB/Swiss-Prot Function:
Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. In response to oxidative stress, phosphorylates serine/threonine kinase PRKD2 at 'Tyr-717' (PubMed:28428613). ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner. Phosphorylates TBX21 on tyrosine residues leading to an enhancement of its transcriptional activator activity (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216; EC=2.7.10.2; Evidence={ECO:0000255 PROSITE-ProRule:PRU10028, ECO:0000269 PubMed:20357770, ECO:0000269 PubMed:28428613};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Stabilized in the inactive form by an association between the SH3 domain and the SH2-TK linker region, interactions of the N-terminal cap, and contributions from an N-terminal myristoyl group and phospholipids. Activated by autophosphorylation as well as by SRC-family kinase-mediated phosphorylation. Activated by RIN1 binding to the SH2 and SH3 domains. Also stimulated by cell death inducers and DNA-damage. Phosphatidylinositol 4,5-bisphosphate (PIP2), a highly abundant phosphoinositide known to regulate cytoskeletal and membrane proteins, inhibits also the tyrosine kinase activity (By similarity). Activated by 5-(1,3-diaryl-1H-pyrazol-4-yl)hydantoin, 5-[3-(4-fluorophenyl)-1-phenyl-1H-pyrazol-4-yl]-2,4-imidazolidinedione (DPH) (PubMed:28428613). Inhibited by ABI1, whose activity is controlled by ABL1 itself through tyrosine phosphorylation. Also inhibited by imatinib mesylate (Gleevec) which is used for the treatment of chronic myeloid leukemia (CML), and by VX-680, an inhibitor that acts also on imatinib-resistant mutants (PubMed:28428613).
GENATLAS Biochemistry:
Abelson murine leukemia viral (v-abl) oncogene homolog 1,nucleocytoplasmic shuttling protein,with a loss from the nucleus upon adhesion to fibronectin matrix,,activated by certain DNA-damaging agents from ionizing radiation to alkylating agents,promoting cell cycle arrest by blocking the G/S transition-in a TP53 dependent way,regulated by ATM,requiring mitogen-activated protein kinase kinase 6 activation (MAP2K6) for inducing apoptosis,activating TP73 in a mismatch repair dependent apoptosis pathway and MAP2K6 (for CABL induced apoptosis)

Enzyme Numbers (IUBMB) for ABL1 Gene

Phenotypes From GWAS Catalog for ABL1 Gene

Gene Ontology (GO) - Molecular Function for ABL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IDA 9144171
GO:0000400 four-way junction DNA binding IDA 9558345
GO:0000405 bubble DNA binding IDA 9558345
GO:0001784 phosphotyrosine residue binding IPI 20624904
GO:0003677 DNA binding NAS 8242749
genes like me logo Genes that share ontologies with ABL1: view

Phenotypes for ABL1 Gene

genes like me logo Genes that share phenotypes with ABL1: view

Human Phenotype Ontology for ABL1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for ABL1 Gene

MGI Knock Outs for ABL1:

Animal Model Products

CRISPR Products

miRNA for ABL1 Gene

miRTarBase miRNAs that target ABL1

Clone Products

  • Addgene plasmids for ABL1

No data available for Transcription Factor Targets and HOMER Transcription for ABL1 Gene

Localization for ABL1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ABL1 Gene

Cytoplasm, cytoskeleton. Nucleus. Mitochondrion. Note=Shuttles between the nucleus and cytoplasm depending on environmental signals. Sequestered into the cytoplasm through interaction with 14-3-3 proteins. Localizes to mitochondria in response to oxidative stress (By similarity). {ECO:0000250}.
Isoform IB: Nucleus membrane; Lipid-anchor. Note=The myristoylated c-ABL protein is reported to be nuclear.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ABL1 gene
Compartment Confidence
cytoskeleton 5
nucleus 5
cytosol 5
mitochondrion 4
plasma membrane 3
extracellular 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (4)
  • Nuclear bodies (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ABL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus TAS 20841568
GO:0005654 nucleoplasm TAS --
GO:0005730 nucleolus IDA 12944467
GO:0005737 cytoplasm IDA,TAS 20841568
GO:0005739 mitochondrion NAS 24522549
genes like me logo Genes that share ontologies with ABL1: view

Pathways & Interactions for ABL1 Gene

genes like me logo Genes that share pathways with ABL1: view

Gene Ontology (GO) - Biological Process for ABL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000278 mitotic cell cycle TAS 24522549
GO:0001843 neural tube closure IEA --
GO:0001922 B-1 B cell homeostasis IEA --
GO:0001934 positive regulation of protein phosphorylation IMP 24700464
GO:0002322 B cell proliferation involved in immune response IEA --
genes like me logo Genes that share ontologies with ABL1: view

Drugs & Compounds for ABL1 Gene

(84) Drugs for ABL1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dasatinib Approved, Investigational Pharma Target, multitarget, Inhibition, inhibitor Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 312
Nilotinib Approved, Investigational Pharma Target, inhibitor, Inhibition Kinase Inhibitors 0
imatinib Approved Pharma Target, inhibitor Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 0
bosutinib Approved Pharma Target, inhibitor Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 0
Ponatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors, Fibroblast growth factor receptor (FGFR)inhibitors 53

(19) Additional Compounds for ABL1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
N-desmethylimatinib
  • CGP74588
AP 24534
943319-70-8

(2) Tocris Compounds for ABL1 Gene

Compound Action Cas Number
AP 24534 Potent multi-kinase and pan-Bcr-Abl inhibitor 943319-70-8
Imatinib mesylate Potent and selective v-Abl tyrosine kinase inhibitor; also inhibits PDGFR and c-kit 220127-57-1

(25) ApexBio Compounds for ABL1 Gene

Compound Action Cas Number
1-Naphthyl PP1 Src family kinases inhibitor 221243-82-9
Adaphostin P210bcr/abl tyrosine kinase inhibitor 241127-58-2
AT9283 Aurora kinase/JAK inhibitor 896466-04-9
Bafetinib (INNO-406) Bcr-Abl/Lyn tyrosine kinase inhibitor 887650-05-7
Bosutinib (SKI-606) Potent Abl/Src kinases 380843-75-4
CHMFL-ABL-053 BCR-ABL inhibitor 1808287-83-3
Dasatinib (BMS-354825) Src and BCR-Abl inhibitor 302962-49-8
DCC-2036 (Rebastinib) Bcr-Abl inhibitor 1020172-07-9
DPH c-ABL activitor 484049-04-9
GNF 2 Bcr-Abl inhibitor 778270-11-4
GNF 5 Bcr-Abl inhibitor 778277-15-9
GNF-7 839706-07-9
GZD824 Bcr-Abl inhibitor,novel orally bioavailable 1421783-64-3
Imatinib (STI571) Protein-tyrosine kinase inhibitor 152459-95-5
Imatinib Mesylate (STI571) Abl/c-kit/PDGFR inhibitor 220127-57-1
KW 2449 Multikinase inhibitor 1000669-72-6
Nilotinib(AMN-107) Bcr-Abl kinase inhibitor,selective 641571-10-0
ON 146040 1404231-34-0
PD 180970 P210bcr/abl tyrosine kinase inhibitor 287204-45-9
PD173955 Dual Src/Abl kinase inhibitor, ATP-competitive, 260415-63-2
Ponatinib (AP24534) pan-BCR-ABL inhibitor,multi-kinase inhibitor 943319-70-8
PP121 Dual inhibitor of tyrosine and phosphoinositide kinases 1092788-83-4
PPY A Bl kinases inhibitor 875634-01-8
Saracatinib (AZD0530) Src/Abl inhibitor,potent and selective 379231-04-6
XL228 IGF1R/AURORA /FGFR1-3/ABL/SRC family kinases inhibitor 898280-07-4
genes like me logo Genes that share compounds with ABL1: view

Transcripts for ABL1 Gene

mRNA/cDNA for ABL1 Gene

(2) REFSEQ mRNAs :
(21) Additional mRNA sequences :
(43) Selected AceView cDNA sequences:
(3) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

  • Addgene plasmids for ABL1

Alternative Splicing Database (ASD) splice patterns (SP) for ABL1 Gene

No ASD Table

Relevant External Links for ABL1 Gene

GeneLoc Exon Structure for
ABL1
ECgene alternative splicing isoforms for
ABL1

Expression for ABL1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ABL1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ABL1 Gene

This gene is overexpressed in Testis (17.7), Ovary (12.9), CD8 Tcells (7.3), and Pancreas (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ABL1 Gene



Protein tissue co-expression partners for ABL1 Gene

NURSA nuclear receptor signaling pathways regulating expression of ABL1 Gene:

ABL1

SOURCE GeneReport for Unigene cluster for ABL1 Gene:

Hs.431048

mRNA Expression by UniProt/SwissProt for ABL1 Gene:

P00519-ABL1_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for ABL1 Gene

  • Nervous system(4.8)
  • Lung(4.4)
  • Liver(4.3)
  • Bone marrow(3.5)
  • Blood(3.3)
  • Skin(3.1)
  • Spleen(2.5)
  • Lymph node(2.2)
  • Heart(2.1)
  • Intestine(2.1)
  • Muscle(2.1)
  • Kidney(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for ABL1 Gene

Germ Layers:
  • mesoderm
Systems:
  • immune
  • lymphatic
Regions:
General:
  • blood
  • bone marrow
  • white blood cell
genes like me logo Genes that share expression patterns with ABL1: view

No data available for mRNA differential expression in normal tissues for ABL1 Gene

Orthologs for ABL1 Gene

This gene was present in the common ancestor of animals.

Orthologs for ABL1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ABL1 33 32
  • 99.48 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia ABL1 33
  • 93 (a)
OneToOne
dog
(Canis familiaris)
Mammalia ABL1 33 32
  • 88.36 (n)
OneToOne
cow
(Bos Taurus)
Mammalia ABL1 33 32
  • 87.43 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Abl1 17 33 32
  • 85.46 (n)
rat
(Rattus norvegicus)
Mammalia Abl1 32
  • 85.09 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ABL1 33
  • 85 (a)
OneToOne
chicken
(Gallus gallus)
Aves ABL 33
  • 82 (a)
OneToOne
ABL1 32
  • 78.3 (n)
lizard
(Anolis carolinensis)
Reptilia ABL1 33
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia abl1 32
  • 71.66 (n)
Str.19066 32
zebrafish
(Danio rerio)
Actinopterygii abl1 33 32
  • 70.24 (n)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta Abl 33 34
  • 29 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea R11E3.1 34
  • 37 (a)
T21G5.1 34
  • 36 (a)
kin-9 34
  • 35 (a)
Y50D4B.6 34
  • 35 (a)
T14E8.1b 34
  • 34 (a)
abl-1 33 34
  • 33 (a)
OneToMany
T14E8.1a 34
  • 32 (a)
C25A8.5 34
  • 32 (a)
F23C8.7 34
  • 31 (a)
Y38H6C.20 34
  • 31 (a)
T25B9.4 34
  • 30 (a)
kin-26 34
  • 30 (a)
F57B9.8 34
  • 30 (a)
spe-8 34
  • 30 (a)
Y69E1A.3 34
  • 29 (a)
T25B9.5 34
  • 29 (a)
W02A2.4 34
  • 28 (a)
K09B11.5 34
  • 28 (a)
ZK593.9 34
  • 28 (a)
Y52D5A.2 34
  • 26 (a)
sea squirt
(Ciona savignyi)
Ascidiacea -- 33
  • 62 (a)
OneToMany
Species where no ortholog for ABL1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ABL1 Gene

ENSEMBL:
Gene Tree for ABL1 (if available)
TreeFam:
Gene Tree for ABL1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ABL1: view image

Paralogs for ABL1 Gene

genes like me logo Genes that share paralogs with ABL1: view

Variants for ABL1 Gene

Sequence variations from dbSNP and Humsavar for ABL1 Gene

SNP ID Clin Chr 09 pos Variation AA Info Type
rs1057519758 likely-pathogenic, Chronic myelogenous leukemia 130,872,153(+) T/G coding_sequence_variant, missense_variant
rs1057519771 likely-pathogenic, Chronic myelogenous leukemia 130,872,201(+) G/C