This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative... See more...

Aliases for ABHD2 Gene

Aliases for ABHD2 Gene

  • Abhydrolase Domain Containing 2 2 3 5
  • Abhydrolase Domain-Containing Protein 2 3 4
  • 2-Arachidonoylglycerol Hydrolase 3 4
  • Monoacylglycerol Lipase ABHD2 3 4
  • Progesterone-Sensitive Lipase 3 4
  • Lung Alpha/Beta Hydrolase 2 3 4
  • Protein PHPS1-2 3 4
  • Acetylesterase 3 4
  • LABH2 3 4
  • Alpha/Beta Hydrolase Domain Containing Protein 2 3
  • Testicular Tissue Protein Li 6 3
  • EC 3.1.1'); 54
  • EC 3.1.1.23 4
  • EC 3.1.1.79 4
  • EC 3.1.1.6 4
  • EC 3.1.1 54
  • PHPS1-2 3
  • HS1-2 3

External Ids for ABHD2 Gene

Previous GeneCards Identifiers for ABHD2 Gene

  • GC15P085970
  • GC15P082997
  • GC15P087218
  • GC15P087361
  • GC15P087432
  • GC15P089631
  • GC15P065743

Summaries for ABHD2 Gene

Entrez Gene Summary for ABHD2 Gene

  • This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017]

GeneCards Summary for ABHD2 Gene

ABHD2 (Abhydrolase Domain Containing 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include carboxylic ester hydrolase activity. An important paralog of this gene is ABHD1.

UniProtKB/Swiss-Prot Summary for ABHD2 Gene

  • Progesterone-dependent acylglycerol lipase that catalyzes hydrolysis of endocannabinoid arachidonoylglycerol (AG) from cell membrane (PubMed:26989199). Acts as a progesterone receptor: progesterone-binding activates the acylglycerol lipase activity, mediating degradation of 1-arachidonoylglycerol (1AG) and 2-arachidonoylglycerol (2AG) to glycerol and arachidonic acid (AA) (PubMed:26989199). Also displays an ester hydrolase activity against acetyl ester, butanoate ester and hexadecanoate ester (PubMed:27247428). Plays a key role in sperm capacitation in response to progesterone by mediating degradation of 2AG, an inhibitor of the sperm calcium channel CatSper, leading to calcium influx via CatSper and sperm activation (PubMed:26989199). May also play a role in smooth muscle cells migration (By similarity).

Gene Wiki entry for ABHD2 Gene

Additional gene information for ABHD2 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ABHD2 Gene

Genomics for ABHD2 Gene

GeneHancer (GH) Regulatory Elements for ABHD2 Gene

Promoters and enhancers for ABHD2 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ABHD2 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the ABHD2 gene promoter:
  • aMEF-2
  • C/EBPalpha
  • FOXL1
  • GATA-3
  • HNF-3beta
  • MEF-2A
  • Nkx2-5
  • Pax-2
  • Pax-2a
  • RFX1

Genomic Locations for ABHD2 Gene

Genomic Locations for ABHD2 Gene
chr15:89,087,459-89,202,360
(GRCh38/hg38)
Size:
114,902 bases
Orientation:
Plus strand
chr15:89,630,690-89,745,591
(GRCh37/hg19)
Size:
114,902 bases
Orientation:
Plus strand

Genomic View for ABHD2 Gene

Genes around ABHD2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ABHD2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ABHD2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ABHD2 Gene

Proteins for ABHD2 Gene

  • Protein details for ABHD2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P08910-ABHD2_HUMAN
    Recommended name:
    Monoacylglycerol lipase ABHD2
    Protein Accession:
    P08910
    Secondary Accessions:
    • Q53G48
    • Q53GU0
    • Q5FVD9
    • Q8TC79

    Protein attributes for ABHD2 Gene

    Size:
    425 amino acids
    Molecular mass:
    48315 Da
    Quaternary structure:
    No Data Available

neXtProt entry for ABHD2 Gene

Selected DME Specific Peptides for ABHD2 Gene

P08910:
  • VGFSLGGN
  • GYRCAVLNHLGALPNIELTSPRMFTYGCTWEF
  • VLCCVSVCQGYSALRAQETF
  • VLYVIVRCLNLKSPTAPPDL
  • PLTWMDK
  • ICPGIAN
  • QWDQCRR
  • NSLKEYYE
  • LSRLYTATSLMQIDDN
  • LHGGHLGFFEG
  • TMVICPGI
  • KLAAVAAVLYVIVR
  • YNFLMADNMKKIILSHR

Post-translational modifications for ABHD2 Gene

  • Glycosylation at Asn136
  • Ubiquitination at Lys36, Lys57, and Lys152
  • Modification sites at PhosphoSitePlus

Domains & Families for ABHD2 Gene

Gene Families for ABHD2 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Protein Domains for ABHD2 Gene

Suggested Antigen Peptide Sequences for ABHD2 Gene

GenScript: Design optimal peptide antigens:
  • Protein PHPS1-2 (ABHD2_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P08910

UniProtKB/Swiss-Prot:

ABHD2_HUMAN :
  • Belongs to the AB hydrolase superfamily. AB hydrolase 4 family.
Family:
  • Belongs to the AB hydrolase superfamily. AB hydrolase 4 family.
genes like me logo Genes that share domains with ABHD2: view

Function for ABHD2 Gene

Molecular function for ABHD2 Gene

UniProtKB/Swiss-Prot Function:
Progesterone-dependent acylglycerol lipase that catalyzes hydrolysis of endocannabinoid arachidonoylglycerol (AG) from cell membrane (PubMed:26989199). Acts as a progesterone receptor: progesterone-binding activates the acylglycerol lipase activity, mediating degradation of 1-arachidonoylglycerol (1AG) and 2-arachidonoylglycerol (2AG) to glycerol and arachidonic acid (AA) (PubMed:26989199). Also displays an ester hydrolase activity against acetyl ester, butanoate ester and hexadecanoate ester (PubMed:27247428). Plays a key role in sperm capacitation in response to progesterone by mediating degradation of 2AG, an inhibitor of the sperm calcium channel CatSper, leading to calcium influx via CatSper and sperm activation (PubMed:26989199). May also play a role in smooth muscle cells migration (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+); Xref=Rhea:RHEA:12957, ChEBI:CHEBI:2571, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30089, ChEBI:CHEBI:47622; EC=3.1.1.6; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:12958; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Hydrolyzes glycerol monoesters of long-chain fatty acids.; EC=3.1.1.23; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+); Xref=Rhea:RHEA:12044, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17855, ChEBI:CHEBI:18035, ChEBI:CHEBI:28868; EC=3.1.1.79; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:12045; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-glycerol + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + glycerol + H(+); Xref=Rhea:RHEA:26132, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17754, ChEBI:CHEBI:32395, ChEBI:CHEBI:52392; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:26133; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=butanoate ester + H2O = an aliphatic alcohol + butanoate + H(+); Xref=Rhea:RHEA:47348, ChEBI:CHEBI:2571, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17968, ChEBI:CHEBI:50477; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:47349; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=H2O + hexadecanoate ester = an aliphatic alcohol + H(+) + hexadecanoate; Xref=Rhea:RHEA:47392, ChEBI:CHEBI:2571, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:25835; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:47393; Evidence=. ;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Acylglycerol lipase activity is activated upon binding to progesterone.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=12.4 mM for p-nitrophenyl acetate {ECO:0000269 PubMed:27247428}; KM=11.76 mM for p-nitrophenyl butyrate {ECO:0000269 PubMed:27247428}; KM=17.66 mM for p-nitrophenyl palmitate {ECO:0000269 PubMed:27247428}; Vmax=2.69 umol/sec/mg enzyme toward p-nitrophenyl acetate {ECO:0000269 PubMed:27247428}; Vmax=3.71 umol/sec/mg enzyme toward p-nitrophenyl butyrate {ECO:0000269 PubMed:27247428}; Vmax=1.27 umol/sec/mg enzyme toward p-nitrophenyl palmitate {ECO:0000269 PubMed:27247428}; pH dependence: Optimum pH is 8.5 for p-nitrophenyl palmitate and 7.5 for p- nitrophenyl acetate and p-nitrophenyl butyrate. {ECO:0000269 PubMed:27247428}; Temperature dependence: Optimum temperature is 45 degrees Celsius with p-nitrophenyl palmitate and 30 degrees Celsius with p-nitrophenyl acetate and p-nitrophenyl butyrate. {ECO:0000269 PubMed:27247428};

Enzyme Numbers (IUBMB) for ABHD2 Gene

Phenotypes From GWAS Catalog for ABHD2 Gene

Gene Ontology (GO) - Molecular Function for ABHD2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003707 steroid hormone receptor activity IDA 26989199
GO:0008126 acetylesterase activity IEA --
GO:0016298 lipase activity IBA 21873635
GO:0016787 hydrolase activity IEA --
GO:0033878 hormone-sensitive lipase activity IEA --
genes like me logo Genes that share ontologies with ABHD2: view
genes like me logo Genes that share phenotypes with ABHD2: view

Animal Model Products

  • Taconic Biosciences Mouse Models for ABHD2

CRISPR Products

miRNA for ABHD2 Gene

miRTarBase miRNAs that target ABHD2

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ABHD2

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ABHD2 Gene

Localization for ABHD2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ABHD2 Gene

Cell projection, cilium, flagellum membrane; Single-pass type II membrane protein. Cell membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ABHD2 gene
Compartment Confidence
plasma membrane 5
extracellular 2
nucleus 2
mitochondrion 0
peroxisome 0
endoplasmic reticulum 0
lysosome 0
golgi apparatus 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ABHD2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001669 acrosomal vesicle IEA --
GO:0005886 plasma membrane IEA --
GO:0005929 cilium IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ABHD2: view

Pathways & Interactions for ABHD2 Gene

PathCards logo

SuperPathways for ABHD2 Gene

No Data Available

Interacting Proteins for ABHD2 Gene

Gene Ontology (GO) - Biological Process for ABHD2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0007340 acrosome reaction IEA --
GO:0009611 response to wounding IEA --
GO:0016042 lipid catabolic process IEA --
GO:0030336 negative regulation of cell migration IEA --
genes like me logo Genes that share ontologies with ABHD2: view

No data available for Pathways by source and SIGNOR curated interactions for ABHD2 Gene

Drugs & Compounds for ABHD2 Gene

No Compound Related Data Available

Transcripts for ABHD2 Gene

mRNA/cDNA for ABHD2 Gene

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ABHD2

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for ABHD2 Gene

ExUns: 1 ^ 2a · 2b · 2c · 2d ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b · 8c ^ 9 ^ 10a · 10b · 10c ^ 11a · 11b ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16a · 16b ^
SP1: - - -
SP2: - - - - - - -
SP3: - - -
SP4: - - -
SP5:
SP6:
SP7: - - - - - - - - -
SP8: - - - - - -
SP9: - - - - - - - -
SP10: - - - -
SP11: - - - -

ExUns: 17
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:

Relevant External Links for ABHD2 Gene

GeneLoc Exon Structure for
ABHD2
ECgene alternative splicing isoforms for
ABHD2

Expression for ABHD2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ABHD2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ABHD2 Gene

This gene is overexpressed in Liver (x4.1).

Protein differential expression in normal tissues from HIPED for ABHD2 Gene

This gene is overexpressed in Heart (41.4) and Liver (24.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ABHD2 Gene



Protein tissue co-expression partners for ABHD2 Gene

NURSA nuclear receptor signaling pathways regulating expression of ABHD2 Gene:

ABHD2

SOURCE GeneReport for Unigene cluster for ABHD2 Gene:

Hs.122337

mRNA Expression by UniProt/SwissProt for ABHD2 Gene:

P08910-ABHD2_HUMAN
Tissue specificity: Present in sperm (at protein level).

Evidence on tissue expression from TISSUES for ABHD2 Gene

  • Liver(4.5)
  • Nervous system(3.9)
  • Intestine(2.9)
  • Lung(2.6)
genes like me logo Genes that share expression patterns with ABHD2: view

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for ABHD2 Gene

Orthologs for ABHD2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ABHD2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ABHD2 33 32
  • 99.53 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia ABHD2 33
  • 95 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia -- 33
  • 93 (a)
OneToMany
-- 33
  • 90 (a)
OneToMany
dog
(Canis familiaris)
Mammalia ABHD2 33 32
  • 92.16 (n)
OneToOne
cow
(Bos Taurus)
Mammalia ABHD2 33 32
  • 92 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Abhd2 17 33 32
  • 91.53 (n)
rat
(Rattus norvegicus)
Mammalia Abhd2 32
  • 91.06 (n)
chicken
(Gallus gallus)
Aves ABHD2 33 32
  • 80.47 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia ABHD2 33
  • 87 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia abhd2 32
  • 73.84 (n)
zebrafish
(Danio rerio)
Actinopterygii abhd2b 33
  • 76 (a)
OneToMany
abhd2a 33
  • 75 (a)
OneToMany
zgc55722 32
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.5024 32
fruit fly
(Drosophila melanogaster)
Insecta Hydr2 33 32
  • 53.54 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008542 32
  • 50.36 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes -- 33
  • 18 (a)
ManyToMany
EHT1 33
  • 17 (a)
ManyToMany
EEB1 33
  • 17 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.9408 33
  • 42 (a)
OneToOne
Species where no ortholog for ABHD2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for ABHD2 Gene

ENSEMBL:
Gene Tree for ABHD2 (if available)
TreeFam:
Gene Tree for ABHD2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ABHD2: view image

Paralogs for ABHD2 Gene

Paralogs for ABHD2 Gene

genes like me logo Genes that share paralogs with ABHD2: view

Variants for ABHD2 Gene

Sequence variations from dbSNP and Humsavar for ABHD2 Gene

SNP ID Clin Chr 15 pos Variation AA Info Type
rs1000048597 -- 89,104,073(+) A/G genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant
rs1000079589 -- 89,097,913(+) G/A genic_upstream_transcript_variant, intron_variant
rs1000080088 -- 89,145,262(+) G/A intron_variant
rs1000148780 -- 89,099,330(+) G/A genic_upstream_transcript_variant, intron_variant
rs1000157687 -- 89,149,317(+) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for ABHD2 Gene

Variant ID Type Subtype PubMed ID
dgv459e214 CNV gain 21293372
esv3637182 CNV loss 21293372
nsv1038140 CNV gain 25217958
nsv1050740 CNV loss 25217958
nsv473088 CNV novel sequence insertion 20440878
nsv507795 OTHER sequence alteration 20534489
nsv523275 CNV loss 19592680
nsv977755 CNV duplication 23825009

Variation tolerance for ABHD2 Gene

Residual Variation Intolerance Score: 23.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.24; 24.85% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ABHD2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ABHD2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ABHD2 Gene

Disorders for ABHD2 Gene

Additional Disease Information for ABHD2

No disorders were found for ABHD2 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ABHD2 Gene

Publications for ABHD2 Gene

  1. Molecular characterization of human ABHD2 as TAG lipase and ester hydrolase. (PMID: 27247428) M NK … J S B (Bioscience reports 2016) 2 3 4 56
  2. Regulation of calcium release from the endoplasmic reticulum by the serine hydrolase ABHD2. (PMID: 28684316) Yun B … Leslie CC (Biochemical and biophysical research communications 2017) 2 3 56
  3. Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone. (PMID: 26989199) Miller MR … Lishko PV (Science (New York, N.Y.) 2016) 3 4 56
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 56
  5. Primary structure of a human protein which bears structural similarities to members of the rhodopsin/beta-adrenergic receptor family. (PMID: 2843827) Rapiejko PJ … Malbon CC (Nucleic acids research 1988) 3 4 56

Products for ABHD2 Gene

Sources for ABHD2 Gene