Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PMPCB Gene

Aliases for PMPCB Gene

  • Peptidase, Mitochondrial Processing Beta Subunit 2 3 5
  • Peptidase (Mitochondrial Processing) Beta 2 3
  • EC 3.4.24.64 4 58
  • Beta-MPP 3 4
  • MPPB 3 4
  • P-52 3 4
  • Mitochondrial Processing Peptidase Beta Subunit 3
  • Mitochondrial-Processing Peptidase Subunit Beta 3
  • MPPP52 3
  • MPP11 3

External Ids for PMPCB Gene

Previous GeneCards Identifiers for PMPCB Gene

  • GC07P101421
  • GC07P102484
  • GC07P102498
  • GC07P102532
  • GC07P102725
  • GC07P102937
  • GC07P097300

Summaries for PMPCB Gene

Entrez Gene Summary for PMPCB Gene

  • This gene is a member of the peptidase M16 family and encodes a protein with a zinc-binding motif. This protein is located in the mitochondrial matrix and catalyzes the cleavage of the leader peptides of precursor proteins newly imported into the mitochondria, though it only functions as part of a heterodimeric complex. [provided by RefSeq, Jul 2008]

GeneCards Summary for PMPCB Gene

PMPCB (Peptidase, Mitochondrial Processing Beta Subunit) is a Protein Coding gene. Among its related pathways are Mitochondrial protein import and Metabolism of proteins. GO annotations related to this gene include metalloendopeptidase activity. An important paralog of this gene is UQCRC1.

UniProtKB/Swiss-Prot for PMPCB Gene

  • Cleaves presequences (transit peptides) from mitochondrial protein precursors.

Gene Wiki entry for PMPCB Gene

Additional gene information for PMPCB Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PMPCB Gene

Genomics for PMPCB Gene

Regulatory Elements for PMPCB Gene

Enhancers for PMPCB Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH07H102572 1.1 ENCODE 41.1 -724.7 -724742 1 ARNT SIN3A FEZF1 ZNF2 ZNF416 ZNF143 ZNF207 SP3 REST ZNF592 CRYZP1 ENSG00000213385 DNAJC2 PMPCB PRKRIP1 FAM185A ENSG00000239486 NAPEPLD LRWD1 S100A11P1
GH07H103343 1.2 ENCODE 22.2 +47.0 47007 2 MLX ZFP64 DMAP1 YY1 SLC30A9 ZNF143 SP3 SSRP1 GLIS1 NBN DNAJC2 CRYZP1 PMPCB ENSG00000239486 ENSG00000213385 ORC5 POLR2J3 DPY19L2P2 PSMC2
GH07H102987 1.6 Ensembl ENCODE dbSUPER 13.1 -306.1 -306058 6 HDGF PKNOX1 FOXA2 ARNT FEZF1 ZNF2 ZNF766 CBX5 FOS DEK PRKRIP1 ENSG00000213385 CRYZP1 ENSG00000239486 DNAJC2 PMPCB ALKBH4 DPY19L2P2 LRRC17 ARMC10
GH07H103146 1.7 FANTOM5 ENCODE dbSUPER 10.6 -147.8 -147759 7 HDGF PKNOX1 ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ZNF766 RPL23AP95 NAPEPLD DPY19L2P2 PMPCB RASA4DP ARMC10 LOC105375434
GH07H103660 1.3 Ensembl ENCODE 12.6 +364.3 364286 3 PKNOX1 FOXA2 MLX ARNT ARID4B DMAP1 YY1 SLC30A9 ZNF766 FOS CRYZP1 ENSG00000213385 PMPCB FAM185A ORC5 DNAJC2 RELN RPL19P12 GC07P103649 GC07P103650
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PMPCB on UCSC Golden Path with GeneCards custom track

Promoters for PMPCB Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000216206 378 1201 PKNOX1 MLX ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 CBX5 ZNF207

Genomic Location for PMPCB Gene

Chromosome:
7
Start:
103,297,422 bp from pter
End:
103,329,902 bp from pter
Size:
32,481 bases
Orientation:
Plus strand

Genomic View for PMPCB Gene

Genes around PMPCB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PMPCB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PMPCB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PMPCB Gene

Proteins for PMPCB Gene

  • Protein details for PMPCB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O75439-MPPB_HUMAN
    Recommended name:
    Mitochondrial-processing peptidase subunit beta
    Protein Accession:
    O75439
    Secondary Accessions:
    • O60416
    • Q96FV4

    Protein attributes for PMPCB Gene

    Size:
    489 amino acids
    Molecular mass:
    54366 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Heterodimer of alpha and beta subunits.

neXtProt entry for PMPCB Gene

Selected DME Specific Peptides for PMPCB Gene

O75439:
  • WIDAGSR
  • RKDLVDYITTHYKGPRIVLAAAGGV
  • PALPPCKFTGSEIRVRDDKMPLAHLA
  • QVVLNVPET
  • REVCTKYIY
  • VILREMQEVE
  • HFLEHMAFKGT
  • VQKEWMRLCT
  • HLNAYTSRE
  • LGRTILGP
  • ILADIIQNS
  • AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLA

Post-translational modifications for PMPCB Gene

  • Ubiquitination at Lys95, Lys224, posLast=235235, and posLast=472472
  • Modification sites at PhosphoSitePlus

Domains & Families for PMPCB Gene

Gene Families for PMPCB Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

O75439

UniProtKB/Swiss-Prot:

MPPB_HUMAN :
  • Belongs to the peptidase M16 family.
Family:
  • Belongs to the peptidase M16 family.
genes like me logo Genes that share domains with PMPCB: view

Function for PMPCB Gene

Molecular function for PMPCB Gene

GENATLAS Biochemistry:
peptidase (mitochondrial processing) beta,M phase phosphoprotein
UniProtKB/Swiss-Prot CatalyticActivity:
Release of N-terminal transit peptides from precursor proteins imported into the mitochondrion, typically with Arg in position P2.
UniProtKB/Swiss-Prot Function:
Cleaves presequences (transit peptides) from mitochondrial protein precursors.

Enzyme Numbers (IUBMB) for PMPCB Gene

Gene Ontology (GO) - Molecular Function for PMPCB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004222 metalloendopeptidase activity IEA,TAS --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0008270 zinc ion binding IBA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PMPCB: view
genes like me logo Genes that share phenotypes with PMPCB: view

Animal Models for PMPCB Gene

MGI Knock Outs for PMPCB:

Animal Model Products

CRISPR Products

miRNA for PMPCB Gene

miRTarBase miRNAs that target PMPCB

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PMPCB
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PMPCB Gene

Localization for PMPCB Gene

Subcellular locations from UniProtKB/Swiss-Prot for PMPCB Gene

Mitochondrion matrix.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PMPCB gene
Compartment Confidence
mitochondrion 5

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PMPCB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IDA --
GO:0005743 mitochondrial inner membrane IEA,TAS --
GO:0005750 mitochondrial respiratory chain complex III IBA --
GO:0005759 mitochondrial matrix IEA --
genes like me logo Genes that share ontologies with PMPCB: view

Pathways & Interactions for PMPCB Gene

genes like me logo Genes that share pathways with PMPCB: view

Pathways by source for PMPCB Gene

2 Reactome pathways for PMPCB Gene

Gene Ontology (GO) - Biological Process for PMPCB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c IBA --
GO:0006508 proteolysis IEA --
GO:0006851 mitochondrial calcium ion transport TAS --
GO:0009060 aerobic respiration IBA --
GO:0016485 protein processing IBA --
genes like me logo Genes that share ontologies with PMPCB: view

No data available for SIGNOR curated interactions for PMPCB Gene

Drugs & Compounds for PMPCB Gene

No Compound Related Data Available

Transcripts for PMPCB Gene

Unigene Clusters for PMPCB Gene

Peptidase (mitochondrial processing) beta:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PMPCB
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for PMPCB Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b ^ 7a · 7b ^ 8 ^ 9a · 9b ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b
SP1: - - - -
SP2: - - - -
SP3: - - -
SP4: - -
SP5: - - - - - -
SP6:
SP7:
SP8:

Relevant External Links for PMPCB Gene

GeneLoc Exon Structure for
PMPCB
ECgene alternative splicing isoforms for
PMPCB

Expression for PMPCB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PMPCB Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PMPCB Gene

This gene is overexpressed in Peripheral blood mononuclear cells (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PMPCB Gene



Protein tissue co-expression partners for PMPCB Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PMPCB Gene:

PMPCB

SOURCE GeneReport for Unigene cluster for PMPCB Gene:

Hs.184211

Evidence on tissue expression from TISSUES for PMPCB Gene

  • Nervous system(4.7)
  • Liver(4.4)
  • Blood(4.3)
  • Lung(2.8)
  • Intestine(2.5)
  • Kidney(2.3)
genes like me logo Genes that share expression patterns with PMPCB: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PMPCB Gene

Orthologs for PMPCB Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PMPCB Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PMPCB 34 33
  • 99.52 (n)
OneToOne
cow
(Bos Taurus)
Mammalia PMPCB 33 34
  • 92.64 (n)
dog
(Canis familiaris)
Mammalia PMPCB 33 34
  • 90.42 (n)
mouse
(Mus musculus)
Mammalia Pmpcb 16 34 33
  • 85.48 (n)
rat
(Rattus norvegicus)
Mammalia Pmpcb 33
  • 83.71 (n)
oppossum
(Monodelphis domestica)
Mammalia PMPCB 34
  • 77 (a)
OneToOne
chicken
(Gallus gallus)
Aves PMPCB 33 34
  • 76.36 (n)
lizard
(Anolis carolinensis)
Reptilia PMPCB 34
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pmpcb 33
  • 75.65 (n)
Str.15357 33
zebrafish
(Danio rerio)
Actinopterygii pmpcb 33 34
  • 70.54 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.10147 33
fruit fly
(Drosophila melanogaster)
Insecta CG3731 35 33 34
  • 60.67 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000935 33
  • 58.66 (n)
worm
(Caenorhabditis elegans)
Secernentea mppb-1 33 34
  • 55.56 (n)
ZC410.2 35
  • 50 (a)
F56D2.1 35
  • 38 (a)
ucr-1 34
  • 38 (a)
ManyToMany
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0D18095g 33
  • 54.21 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes MAS1 33 34 36
  • 52.94 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGL138C 33
  • 51.69 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons MPPBETA 33
  • 56.04 (n)
soybean
(Glycine max)
eudicotyledons Gma.1751 33
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.6917 33
rice
(Oryza sativa)
Liliopsida Os03g0212700 33
  • 55 (n)
Os.4124 33
barley
(Hordeum vulgare)
Liliopsida Hv.5304 33
wheat
(Triticum aestivum)
Liliopsida Ta.27578 33
corn
(Zea mays)
Liliopsida Zm.5860 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3431 34
  • 63 (a)
OneToMany
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes qcr1 33
  • 54.36 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU02549 33
  • 53.68 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4874 33
Species where no ortholog for PMPCB was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for PMPCB Gene

ENSEMBL:
Gene Tree for PMPCB (if available)
TreeFam:
Gene Tree for PMPCB (if available)

Paralogs for PMPCB Gene

Paralogs for PMPCB Gene

(3) SIMAP similar genes for PMPCB Gene using alignment to 8 proteins:

genes like me logo Genes that share paralogs with PMPCB: view

Variants for PMPCB Gene

Sequence variations from dbSNP and Humsavar for PMPCB Gene

SNP ID Clin Chr 07 pos Sequence Context AA Info Type
rs1000022831 -- 103,296,501(+) TAGTT(A/C)CTTGA upstream-variant-2KB
rs1000267442 -- 103,320,966(+) TCCAA(C/G)GCAGG intron-variant
rs1000442108 -- 103,315,041(+) TAATG(A/G)GTGTA intron-variant, downstream-variant-500B
rs1000732248 -- 103,301,728(+) CTGGT(A/G)TATGA intron-variant
rs1000784337 -- 103,321,271(+) CCCAA(C/T)ACTTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PMPCB Gene

Variant ID Type Subtype PubMed ID
nsv831084 CNV gain 17160897

Variation tolerance for PMPCB Gene

Residual Variation Intolerance Score: 39.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.11; 69.20% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PMPCB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PMPCB

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PMPCB Gene

Disorders for PMPCB Gene

Relevant External Links for PMPCB

Genetic Association Database (GAD)
PMPCB
Human Genome Epidemiology (HuGE) Navigator
PMPCB
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PMPCB

No disorders were found for PMPCB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PMPCB Gene

Publications for PMPCB Gene

  1. Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning. (PMID: 9653160) Mao M … Chen Z (Proceedings of the National Academy of Sciences of the United States of America 1998) 2 3 4 60
  2. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 45 60
  3. The DNA sequence of human chromosome 7. (PMID: 12853948) Hillier LW … Wilson RK (Nature 2003) 3 4 60
  4. Maturation of wild-type and mutated frataxin by the mitochondrial processing peptidase. (PMID: 9700204) Koutnikova H … Koenig M (Human molecular genetics 1998) 3 22 60
  5. Architecture of the human interactome defines protein communities and disease networks. (PMID: 28514442) Huttlin EL … Harper JW (Nature 2017) 3 60

Products for PMPCB Gene

Sources for PMPCB Gene

Content
Loading form....