Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ST8SIA4 Gene

Aliases for ST8SIA4 Gene

  • ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 4 2 3 5
  • ST8 Alpha-N-Acetylneuraminate Alpha-2,8-Sialyltransferase 4 2 3
  • Sialyltransferase 8 (Alpha-2, 8-Polysialytransferase) D 2 3
  • Alpha-2,8-Sialyltransferase 8D 3 4
  • Sialyltransferase St8Sia IV 3 4
  • Polysialyltransferase-1 3 4
  • Sialyltransferase 8D 3 4
  • ST8SiaIV 3 4
  • SIAT8-D 3 4
  • SIAT8D 3 4
  • PST1 3 4
  • PST 3 4
  • CMP-N-Acetylneuraminate-Poly-Alpha-2,8-Sialyl Transferase 3
  • CMP-N-Acetylneuraminate-Poly-Alpha-2,8-Sialyltransferase 3
  • Sialytransferase St8Sia IV 3
  • EC 2.4.99.- 4
  • ST8Sia IV 2
  • ST8SIA-IV 3
  • EC 2.4.99 61

External Ids for ST8SIA4 Gene

Previous HGNC Symbols for ST8SIA4 Gene

  • SIAT8D

Previous GeneCards Identifiers for ST8SIA4 Gene

  • GC05M100171
  • GC05M095326

Summaries for ST8SIA4 Gene

Entrez Gene Summary for ST8SIA4 Gene

  • The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for ST8SIA4 Gene

ST8SIA4 (ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 4) is a Protein Coding gene. Diseases associated with ST8SIA4 include Granuloma Inguinale. Among its related pathways are Developmental Biology and Synthesis of substrates in N-glycan biosythesis. GO annotations related to this gene include sialyltransferase activity and alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity. An important paralog of this gene is ST8SIA2.

UniProtKB/Swiss-Prot for ST8SIA4 Gene

  • Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.

Gene Wiki entry for ST8SIA4 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ST8SIA4 Gene

Genomics for ST8SIA4 Gene

Regulatory Elements for ST8SIA4 Gene

Enhancers for ST8SIA4 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH05G100825 1.8 FANTOM5 Ensembl ENCODE dbSUPER 8.7 +75.9 75881 3.8 TBP PKNOX1 TBL1XR1 SIN3A BMI1 ZBTB7B FOS RELB ETV6 IKZF2 ST8SIA4 MIR548P GC05M100870
GH05G100840 1.7 FANTOM5 Ensembl ENCODE dbSUPER 8.6 +61.7 61726 3.0 TBP JUN ZSCAN4 BACH1 ZIC2 RELA ARID3A GATA2 EED RELB MIR548P ST8SIA4 GC05M100870
GH05G100897 1.6 FANTOM5 ENCODE dbSUPER 8.3 +1.5 1539 8.2 HDGF PKNOX1 WRNIP1 SIN3A GLIS2 ELK1 ZNF143 ZNF207 SP3 JUNB ST8SIA4 GC05M100870
GH05G100776 1.5 FANTOM5 Ensembl ENCODE 7.7 +125.8 125760 2.2 HDGF TBP ZNF133 BMI1 RFX5 GATA2 CBX5 FOS RELB ETV6 MIR548P ST8SIA4 RN7SKP62
GH05G100777 0.5 FANTOM5 18.3 +127.3 127323 0.3 BHLHE40 TBX21 ST8SIA4 MIR548P RN7SKP62
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ST8SIA4 on UCSC Golden Path with GeneCards custom track

Promoters for ST8SIA4 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000184625 685 4801 HDGF PKNOX1 WRNIP1 SIN3A GLIS2 ELK1 ZNF143 ZNF207 SP3 JUNB

Genomic Location for ST8SIA4 Gene

Chromosome:
5
Start:
100,806,935 bp from pter
End:
100,903,285 bp from pter
Size:
96,351 bases
Orientation:
Minus strand

Genomic View for ST8SIA4 Gene

Genes around ST8SIA4 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ST8SIA4 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ST8SIA4 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ST8SIA4 Gene

Proteins for ST8SIA4 Gene

  • Protein details for ST8SIA4 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q92187-SIA8D_HUMAN
    Recommended name:
    CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
    Protein Accession:
    Q92187
    Secondary Accessions:
    • A8KA07
    • G3V104
    • Q8N1F4
    • Q92693

    Protein attributes for ST8SIA4 Gene

    Size:
    359 amino acids
    Molecular mass:
    41295 Da
    Quaternary structure:
    No Data Available

    Alternative splice isoforms for ST8SIA4 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ST8SIA4 Gene

Selected DME Specific Peptides for ST8SIA4 Gene

Q92187:
  • LSRSLVNSSDKIIRKAGS
  • HAVRGYWLTNKV
  • TGLLMYTLATRFC
  • LHSLLPEVSPMKNRRFKTCAVVGNSGILLDS
  • CGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSV
  • LYGFWPF
  • VRTAYPSL
  • VEWVNALILK

Post-translational modifications for ST8SIA4 Gene

  • Glycosylation at Asn50, Asn74, posLast=119119, Asn204, Asn219, and Asn327
  • Modification sites at PhosphoSitePlus

Other Protein References for ST8SIA4 Gene

Domains & Families for ST8SIA4 Gene

Gene Families for ST8SIA4 Gene

Protein Domains for ST8SIA4 Gene

Suggested Antigen Peptide Sequences for ST8SIA4 Gene

Graphical View of Domain Structure for InterPro Entry

Q92187

UniProtKB/Swiss-Prot:

SIA8D_HUMAN :
  • Belongs to the glycosyltransferase 29 family.
Family:
  • Belongs to the glycosyltransferase 29 family.
genes like me logo Genes that share domains with ST8SIA4: view

Function for ST8SIA4 Gene

Molecular function for ST8SIA4 Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.

Enzyme Numbers (IUBMB) for ST8SIA4 Gene

Gene Ontology (GO) - Molecular Function for ST8SIA4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003828 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity TAS --
GO:0008373 sialyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016757 transferase activity, transferring glycosyl groups IEA --
GO:0033691 sialic acid binding IC 10766765
genes like me logo Genes that share ontologies with ST8SIA4: view
genes like me logo Genes that share phenotypes with ST8SIA4: view

Animal Models for ST8SIA4 Gene

MGI Knock Outs for ST8SIA4:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ST8SIA4 Gene

Localization for ST8SIA4 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ST8SIA4 Gene

Golgi apparatus membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ST8SIA4 gene
Compartment Confidence
golgi apparatus 5
mitochondrion 2
nucleus 1
cytosol 1

Gene Ontology (GO) - Cellular Components for ST8SIA4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005794 Golgi apparatus IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0030173 integral component of Golgi membrane IEA --
genes like me logo Genes that share ontologies with ST8SIA4: view

Pathways & Interactions for ST8SIA4 Gene

genes like me logo Genes that share pathways with ST8SIA4: view

UniProtKB/Swiss-Prot Q92187-SIA8D_HUMAN

  • Pathway: Protein modification; protein glycosylation.

Interacting Proteins for ST8SIA4 Gene

Gene Ontology (GO) - Biological Process for ST8SIA4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001574 ganglioside biosynthetic process IDA 10766765
GO:0006464 cellular protein modification process TAS 7854457
GO:0006486 protein glycosylation IEA,IDA --
GO:0006491 N-glycan processing IDA 10766765
GO:0007399 nervous system development TAS 9054414
genes like me logo Genes that share ontologies with ST8SIA4: view

No data available for SIGNOR curated interactions for ST8SIA4 Gene

Drugs & Compounds for ST8SIA4 Gene

(1) Drugs for ST8SIA4 Gene - From: Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials

(3) Additional Compounds for ST8SIA4 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with ST8SIA4: view

Transcripts for ST8SIA4 Gene

Unigene Clusters for ST8SIA4 Gene

ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for ST8SIA4 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6
SP1: - -
SP2:
SP3: -

Relevant External Links for ST8SIA4 Gene

GeneLoc Exon Structure for
ST8SIA4
ECgene alternative splicing isoforms for
ST8SIA4

Expression for ST8SIA4 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ST8SIA4 Gene

mRNA differential expression in normal tissues according to GTEx for ST8SIA4 Gene

This gene is overexpressed in Whole Blood (x13.6).

Protein differential expression in normal tissues from HIPED for ST8SIA4 Gene

This gene is overexpressed in Blymphocyte (44.6) and Neutrophil (17.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ST8SIA4 Gene



Protein tissue co-expression partners for ST8SIA4 Gene

NURSA nuclear receptor signaling pathways regulating expression of ST8SIA4 Gene:

ST8SIA4

SOURCE GeneReport for Unigene cluster for ST8SIA4 Gene:

Hs.308628

mRNA Expression by UniProt/SwissProt for ST8SIA4 Gene:

Q92187-SIA8D_HUMAN
Tissue specificity: Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.

Evidence on tissue expression from TISSUES for ST8SIA4 Gene

  • Nervous system(4.5)
  • Lung(4.3)
  • Spleen(2.2)
genes like me logo Genes that share expression patterns with ST8SIA4: view

Primer Products

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for ST8SIA4 Gene

Orthologs for ST8SIA4 Gene

This gene was present in the common ancestor of chordates.

Orthologs for ST8SIA4 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ST8SIA4 34 35
  • 99.91 (n)
dog
(Canis familiaris)
Mammalia ST8SIA4 34 35
  • 94.89 (n)
cow
(Bos Taurus)
Mammalia ST8SIA4 34 35
  • 93.13 (n)
mouse
(Mus musculus)
Mammalia St8sia4 34 16 35
  • 91.74 (n)
rat
(Rattus norvegicus)
Mammalia St8sia4 34
  • 90.06 (n)
oppossum
(Monodelphis domestica)
Mammalia ST8SIA4 35
  • 88 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ST8SIA4 35
  • 86 (a)
OneToOne
chicken
(Gallus gallus)
Aves ST8SIA4 34 35
  • 85.61 (n)
lizard
(Anolis carolinensis)
Reptilia ST8SIA4 35
  • 92 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia st8sia4 34
  • 79.48 (n)
zebrafish
(Danio rerio)
Actinopterygii st8sia4 34 35
  • 64.97 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.11824 34
Species where no ortholog for ST8SIA4 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for ST8SIA4 Gene

ENSEMBL:
Gene Tree for ST8SIA4 (if available)
TreeFam:
Gene Tree for ST8SIA4 (if available)

Paralogs for ST8SIA4 Gene

Paralogs for ST8SIA4 Gene

(6) SIMAP similar genes for ST8SIA4 Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with ST8SIA4: view

Variants for ST8SIA4 Gene

Sequence variations from dbSNP and Humsavar for ST8SIA4 Gene

SNP ID Clin Chr 05 pos Sequence Context AA Info Type
VAR_036169 A colorectal cancer sample
rs1000006753 -- 100,860,670(+) TCCAA(G/T)GGCAT intron-variant
rs1000043658 -- 100,870,853(+) ATCAC(A/C)ATTTA intron-variant
rs1000068213 -- 100,833,350(+) TAAGT(G/T)GGTTT intron-variant
rs1000091414 -- 100,899,084(+) ATATG(A/G)TTAAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ST8SIA4 Gene

Variant ID Type Subtype PubMed ID
esv3401406 CNV duplication 20981092
esv3605990 CNV loss 21293372
esv3890678 CNV gain 25118596
nsv1021183 CNV gain 25217958
nsv1023765 CNV loss 25217958
nsv472720 CNV novel sequence insertion 20440878
nsv475457 CNV novel sequence insertion 20440878

Variation tolerance for ST8SIA4 Gene

Residual Variation Intolerance Score: 23.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.72; 15.20% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ST8SIA4 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ST8SIA4

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ST8SIA4 Gene

Disorders for ST8SIA4 Gene

MalaCards: The human disease database

(1) MalaCards diseases for ST8SIA4 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
granuloma inguinale
  • donovanosis
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for ST8SIA4

Genetic Association Database (GAD)
ST8SIA4
Human Genome Epidemiology (HuGE) Navigator
ST8SIA4
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ST8SIA4
genes like me logo Genes that share disorders with ST8SIA4: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ST8SIA4 Gene

Publications for ST8SIA4 Gene

  1. Association between polymorphisms in the promoter region of the sialyltransferase 8B (SIAT8B) gene and schizophrenia. (PMID: 16229822) Arai M. … Itokawa M. (Biol. Psychiatry 2006) 3 22 46 64
  2. Unique disulfide bond structures found in ST8Sia IV polysialyltransferase are required for its activity. (PMID: 11279095) Angata K. … Fukuda M. (J. Biol. Chem. 2001) 3 4 22 64
  3. Expression cloning of a human polysialyltransferase that forms the polysialylated neural cell adhesion molecule present in embryonic brain. (PMID: 7624364) Nakayama J. … Fukuda M. (Proc. Natl. Acad. Sci. U.S.A. 1995) 2 3 4 64
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  5. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey S.D. … Anand S. (Diabetes Care 2010) 3 46 64

Products for ST8SIA4 Gene

Sources for ST8SIA4 Gene

Content
Loading form....