Free for academic non-profit institutions. Other users need a Commercial license

Aliases for SIAH1 Gene

Aliases for SIAH1 Gene

  • Siah E3 Ubiquitin Protein Ligase 1 2 3 5
  • RING-Type E3 Ubiquitin Transferase SIAH1 3 4
  • Seven In Absentia Homolog 1 3 4
  • Siah-1a 3 4
  • Seven In Absentia Homolog 1 (Drosophila) 2
  • E3 Ubiquitin-Protein Ligase SIAH1 3
  • EC 2.3.2.27 4
  • EC 6.3.2 58
  • HUMSIAH 4
  • SIAH1A 3
  • Siah-1 4

External Ids for SIAH1 Gene

Previous GeneCards Identifiers for SIAH1 Gene

  • GC16M038809
  • GC16M048443
  • GC16M048131
  • GC16M048172
  • GC16M046951
  • GC16M034285

Summaries for SIAH1 Gene

Entrez Gene Summary for SIAH1 Gene

  • This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008]

GeneCards Summary for SIAH1 Gene

SIAH1 (Siah E3 Ubiquitin Protein Ligase 1) is a Protein Coding gene. Diseases associated with SIAH1 include Parkinson Disease, Late-Onset. Among its related pathways are Netrin-1 signaling and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include identical protein binding and ubiquitin-protein transferase activity. An important paralog of this gene is SIAH2.

UniProtKB/Swiss-Prot for SIAH1 Gene

  • E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.

Gene Wiki entry for SIAH1 Gene

Additional gene information for SIAH1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for SIAH1 Gene

Genomics for SIAH1 Gene

Regulatory Elements for SIAH1 Gene

Enhancers for SIAH1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH16H048364 1.7 FANTOM5 ENCODE dbSUPER 16 +82.2 82224 3 HDGF PKNOX1 FOXA2 ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 LONP2 SIAH1 N4BP1 ENSG00000280067 GC16P048414
GH16H048430 1.4 FANTOM5 Ensembl ENCODE 17 +15.5 15478 4 CTCF PKNOX1 FOXA2 ZFP64 RAD21 POLR2A FOXK2 EED ZNF26 FOS SIAH1 N4BP1 LONP2 ABCC11 ENSG00000275909 GC16P048414
GH16H048602 1.3 Ensembl ENCODE dbSUPER 13.7 -154.8 -154761 2 ZFP64 ZNF140 ZNF266 RAD21 ZNF697 ZNF664 RBAK ZNF354C HNF4G NR2F6 SIAH1 N4BP1 GC16P048601
GH16H048497 1.2 Ensembl ENCODE 13.6 -51.7 -51651 4 PKNOX1 FOXA2 FEZF1 RAD21 RARA ZNF121 ZSCAN5C RCOR1 FOS CEBPB SIAH1 LONP2 MOCS1P1 PIR32085
GH16H047459 1.3 ENCODE dbSUPER 11.2 +986.7 986734 4 PKNOX1 ARID4B SIN3A DMAP1 YY1 ZNF143 ZNF207 SP3 SP5 MXD4 ENSG00000261131 SIAH1 UBA52P8 SHCBP1 GPT2 LONP2 PHKB ITFG1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around SIAH1 on UCSC Golden Path with GeneCards custom track

Genomic Location for SIAH1 Gene

Chromosome:
16
Start:
48,356,364 bp from pter
End:
48,448,440 bp from pter
Size:
92,077 bases
Orientation:
Minus strand

Genomic View for SIAH1 Gene

Genes around SIAH1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
SIAH1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for SIAH1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for SIAH1 Gene

Proteins for SIAH1 Gene

  • Protein details for SIAH1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8IUQ4-SIAH1_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase SIAH1
    Protein Accession:
    Q8IUQ4
    Secondary Accessions:
    • A0FKF3
    • O43269
    • Q49A58
    • Q92880

    Protein attributes for SIAH1 Gene

    Size:
    282 amino acids
    Molecular mass:
    31123 Da
    Quaternary structure:
    • Homodimer. Interacts with group 1 glutamate receptors GRM1 and GRM5. Interacts with DAB1, which may inhibit its activity. Interacts with UBE2E2. Interacts with PEG3. Interacts with GAPDH; leading to stabilize SIAH1 (By similarity). Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I. Interacts with alpha-tubulin. Interacts with PEG10, which may inhibit its activity. Interacts with KHDRBS3. Interacts with SNCAIP and HIPK2.

    Three dimensional structures from OCA and Proteopedia for SIAH1 Gene

    Alternative splice isoforms for SIAH1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for SIAH1 Gene

Selected DME Specific Peptides for SIAH1 Gene

Q8IUQ4:
  • FMLVLEKQE
  • PRSIHEG
  • EKVANSVLFPCKY
  • HKSITTLQGEDIVFLATDI
  • YRLELNG
  • SGHLVCSNCRPKL
  • CPCPGASCKW
  • NGNLGINVTIS
  • RRRLTWEA
  • IRNLAME
  • TTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRP
  • WEATPRSIH
  • LIGTRKQA
  • VLFPCKYA
  • SDCLVFD

Post-translational modifications for SIAH1 Gene

  • Phosphorylated on Ser-19 by ATM and ATR. This phosphorylation disrupts SIAH1 interaction with HIPK2, and subsequent proteasomal degradation of HIPK2.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for SIAH1 Gene

Gene Families for SIAH1 Gene

Human Protein Atlas (HPA):
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for SIAH1 Gene

Graphical View of Domain Structure for InterPro Entry

Q8IUQ4

UniProtKB/Swiss-Prot:

SIAH1_HUMAN :
  • The RING-type zinc finger domain is essential for ubiquitin ligase activity.
  • Belongs to the SINA (Seven in absentia) family.
Domain:
  • The RING-type zinc finger domain is essential for ubiquitin ligase activity.
  • The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family.
Family:
  • Belongs to the SINA (Seven in absentia) family.
genes like me logo Genes that share domains with SIAH1: view

Function for SIAH1 Gene

Molecular function for SIAH1 Gene

GENATLAS Biochemistry:
Drosophila seven in absentia (sina) homolog 1,putatively involved in apoptosis and tumor suppression,also mediating through RING finger ubiquitin-conjugating enzyme (E2)-dependent ubiquitination
UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by interaction with SNCAIP (isoform 2, but not isoform 1). May be inhibited by interaction with PEG10.
UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.
UniProtKB/Swiss-Prot Induction:
May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. The relevance of such activity in vivo is however unclear and may not exist.

Enzyme Numbers (IUBMB) for SIAH1 Gene

Phenotypes From GWAS Catalog for SIAH1 Gene

Gene Ontology (GO) - Molecular Function for SIAH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity TAS --
GO:0005515 protein binding IPI 11389839
GO:0008022 protein C-terminus binding IPI 11389840
GO:0008270 zinc ion binding ISS --
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with SIAH1: view
genes like me logo Genes that share phenotypes with SIAH1: view

Animal Models for SIAH1 Gene

MGI Knock Outs for SIAH1:

Animal Model Products

CRISPR Products

miRNA for SIAH1 Gene

miRTarBase miRNAs that target SIAH1

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for SIAH1
  • Applied Biological Materials Clones for SIAH1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for SIAH1 Gene

Localization for SIAH1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for SIAH1 Gene

Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. Partially nuclear.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for SIAH1 gene
Compartment Confidence
nucleus 5
cytosol 5
mitochondrion 4
cytoskeleton 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (3)
  • Mitochondria (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for SIAH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus ISS,IEA --
GO:0005737 cytoplasm TAS 9334332
GO:0005769 early endosome IEA --
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with SIAH1: view

Pathways & Interactions for SIAH1 Gene

genes like me logo Genes that share pathways with SIAH1: view

UniProtKB/Swiss-Prot Q8IUQ4-SIAH1_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for SIAH1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for SIAH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination TAS --
GO:0006511 ubiquitin-dependent protein catabolic process IEA,IDA 23001567
GO:0006915 apoptotic process TAS 9403064
GO:0007049 cell cycle IEA --
GO:0007275 multicellular organism development IEA --
genes like me logo Genes that share ontologies with SIAH1: view

Drugs & Compounds for SIAH1 Gene

(5) Drugs for SIAH1 Gene - From: DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved Nutra 0
Omigapil Investigational Pharma 0
ATP Nutra Agonist 0

(1) Additional Compounds for SIAH1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with SIAH1: view

Transcripts for SIAH1 Gene

Unigene Clusters for SIAH1 Gene

Siah E3 ubiquitin protein ligase 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for SIAH1
  • Applied Biological Materials Clones for SIAH1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for SIAH1 Gene

No ASD Table

Relevant External Links for SIAH1 Gene

GeneLoc Exon Structure for
SIAH1
ECgene alternative splicing isoforms for
SIAH1

Expression for SIAH1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for SIAH1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for SIAH1 Gene

This gene is overexpressed in Testis (x4.5).

Protein differential expression in normal tissues from HIPED for SIAH1 Gene

This gene is overexpressed in Ovary (38.1) and Placenta (30.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for SIAH1 Gene



Protein tissue co-expression partners for SIAH1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of SIAH1 Gene:

SIAH1

SOURCE GeneReport for Unigene cluster for SIAH1 Gene:

Hs.706828

mRNA Expression by UniProt/SwissProt for SIAH1 Gene:

Q8IUQ4-SIAH1_HUMAN
Tissue specificity: Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas.

Evidence on tissue expression from TISSUES for SIAH1 Gene

  • Nervous system(4.5)
  • Intestine(4.3)
  • Eye(4.2)
  • Pancreas(4.1)
genes like me logo Genes that share expression patterns with SIAH1: view

Primer Products

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for SIAH1 Gene

Orthologs for SIAH1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for SIAH1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia SIAH1 33 34
  • 99.65 (n)
mouse
(Mus musculus)
Mammalia Siah1b 34
  • 98 (a)
OneToMany
Siah1a 33 16 34
  • 92.67 (n)
dog
(Canis familiaris)
Mammalia SIAH1 33 34
  • 93.72 (n)
cow
(Bos Taurus)
Mammalia SIAH1 33 34
  • 93.61 (n)
rat
(Rattus norvegicus)
Mammalia Siah1a 33
  • 91.84 (n)
oppossum
(Monodelphis domestica)
Mammalia SIAH1 34
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves SIAH1 33 34
  • 90.31 (n)
lizard
(Anolis carolinensis)
Reptilia SIAH1 34
  • 95 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia siah1 33
  • 84.75 (n)
Str.642 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.2090 33
zebrafish
(Danio rerio)
Actinopterygii siah1 33 34
  • 76.76 (n)
idibd2635 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006127 33
  • 66.67 (n)
fruit fly
(Drosophila melanogaster)
Insecta sina 35 33
  • 64.56 (n)
CG13030 35
  • 40 (a)
sinah 34
  • 37 (a)
OneToMany
CG2681 34
  • 11 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea Y37E11AR.2 35
  • 67 (a)
siah-1 33
  • 58.5 (n)
rice
(Oryza sativa)
Liliopsida Os07g0659800 33
  • 46.27 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.9219 33
Species where no ortholog for SIAH1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for SIAH1 Gene

ENSEMBL:
Gene Tree for SIAH1 (if available)
TreeFam:
Gene Tree for SIAH1 (if available)

Paralogs for SIAH1 Gene

Paralogs for SIAH1 Gene

(2) SIMAP similar genes for SIAH1 Gene using alignment to 3 proteins:

Pseudogenes.org Pseudogenes for SIAH1 Gene

genes like me logo Genes that share paralogs with SIAH1: view

Variants for SIAH1 Gene

Sequence variations from dbSNP and Humsavar for SIAH1 Gene

SNP ID Clin Chr 16 pos Sequence Context AA Info Type
rs1000029437 -- 48,428,968(+) ACCCA(A/G)CTTCT intron-variant
rs1000089888 -- 48,384,762(+) CTGCC(C/T)GCACT intron-variant
rs1000099341 -- 48,430,552(+) TGATA(C/T)AGTCA intron-variant
rs1000113440 -- 48,387,102(+) ACACA(A/C/G)TGTCC upstream-variant-2KB, utr-variant-5-prime
rs1000136155 -- 48,386,818(+) AGCAG(C/G)TCTGG intron-variant, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for SIAH1 Gene

Variant ID Type Subtype PubMed ID
dgv5109n54 CNV loss 21841781
dgv5110n54 CNV loss 21841781
dgv5111n54 CNV gain+loss 21841781
dgv5112n54 CNV gain 21841781
esv26254 CNV loss 19812545
esv2758645 CNV gain 17122850
nsv1069942 CNV deletion 25765185
nsv1118351 CNV deletion 24896259
nsv1144769 CNV deletion 24896259
nsv572540 CNV loss 21841781
nsv572541 CNV gain 21841781
nsv572546 CNV gain+loss 21841781
nsv572551 CNV gain 21841781
nsv572553 CNV loss 21841781
nsv572555 CNV loss 21841781
nsv833219 CNV gain 17160897
nsv952668 CNV duplication 24416366

Variation tolerance for SIAH1 Gene

Residual Variation Intolerance Score: 54.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.35; 26.78% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for SIAH1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
SIAH1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for SIAH1 Gene

Disorders for SIAH1 Gene

MalaCards: The human disease database

(1) MalaCards diseases for SIAH1 Gene - From: DISEASES and Novoseek

Disorder Aliases PubMed IDs
parkinson disease, late-onset
  • parkinson disease
- elite association - COSMIC cancer census association via MalaCards
Search SIAH1 in MalaCards View complete list of genes associated with diseases

Relevant External Links for SIAH1

Genetic Association Database (GAD)
SIAH1
Human Genome Epidemiology (HuGE) Navigator
SIAH1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
SIAH1
genes like me logo Genes that share disorders with SIAH1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for SIAH1 Gene

Publications for SIAH1 Gene

  1. Mutation analysis of the seven in absentia homolog 1 (SIAH1) gene in Parkinson's disease. (PMID: 16752048) Franck T … Riess O (Journal of neural transmission (Vienna, Austria : 1996) 2006) 3 22 45 60
  2. Structural analysis of Siah1-Siah-interacting protein interactions and insights into the assembly of an E3 ligase multiprotein complex. (PMID: 16085652) Santelli E … Matsuzawa S (The Journal of biological chemistry 2005) 3 4 22 60
  3. SIAH1 targets the alternative splicing factor T-STAR for degradation by the proteasome. (PMID: 15163637) Venables JP … Elliott DJ (Human molecular genetics 2004) 3 4 22 60
  4. Structural analysis of Siah1 and its interactions with Siah-interacting protein (SIP). (PMID: 12421809) Matsuzawa S … Ely KR (The Journal of biological chemistry 2003) 3 4 22 60
  5. Siah-1 facilitates ubiquitination and degradation of synphilin-1. (PMID: 14506261) Nagano Y … Matsumoto M (The Journal of biological chemistry 2003) 3 4 22 60

Products for SIAH1 Gene

  • Addgene plasmids for SIAH1

Sources for SIAH1 Gene

Content
Loading form....