Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TAOK1 Gene

Aliases for TAOK1 Gene

  • TAO Kinase 1 2 3 5
  • Thousand And One Amino Acid Protein Kinase 1 3 4
  • Prostate-Derived Sterile 20-Like Kinase 2 3 4
  • Prostate-Derived STE20-Like Kinase 2 3 4
  • Kinase From Chicken Homolog B 3 4
  • MARK Kinase 3 4
  • EC 2.7.11.1 4 56
  • MAP3K16 3 4
  • HKFC-B 3 4
  • HTAOK1 3 4
  • MARKK 3 4
  • PSK-2 3 4
  • PSK2 3 4
  • Microtubule Affinity Regulating Kinase Kinase 3
  • Serine/Threonine Protein Kinase TAO1 Homolog 3
  • Thousand And One Amino Acid Protein 1 3
  • Serine/Threonine-Protein Kinase TAO1 3
  • STE20-Like Kinase PSK2 3
  • EC 2.7.11 56
  • KIAA1361 4
  • KFC-B 3
  • TAO1 3

External Ids for TAOK1 Gene

Previous GeneCards Identifiers for TAOK1 Gene

  • GC17P024742
  • GC17P027717
  • GC17P023926

Summaries for TAOK1 Gene

GeneCards Summary for TAOK1 Gene

TAOK1 (TAO Kinase 1) is a Protein Coding gene. Diseases associated with TAOK1 include Chromosome 17Q11.2 Deletion Syndrome, 1.4-Mb. Among its related pathways are MAPK signaling pathway and Signaling by Rho GTPases. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TAOK3.

UniProtKB/Swiss-Prot for TAOK1 Gene

  • Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating Thr-208 of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.

Gene Wiki entry for TAOK1 Gene

Additional gene information for TAOK1 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TAOK1 Gene

Genomics for TAOK1 Gene

GeneHancer (GH) Regulatory Elements for TAOK1 Gene

Promoters and enhancers for TAOK1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH17I029389 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 550.8 +0.4 437 2.6 HDGF PKNOX1 SMAD1 FOXA2 ARNT ARID4B SIN3A DMAP1 ZNF2 ZBTB7B ENSG00000264808 MIR4523 TAOK1 RAB34 NSRP1 RPL23A TP53I13 GC17M029394 ENSG00000266111
GH17I029290 Promoter/Enhancer 2.7 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 10 -97.2 -97198 4.8 MLX DMAP1 IRF4 YY1 SLC30A9 ZNF213 E2F8 ZNF143 SP3 NFYC NUFIP2 ENSG00000264577 SUPT6H TMEM199 LOC101927018 PHF12 RPL23A ENSG00000264044 RAB34 MYO18A
GH17I028841 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 9.7 -548.1 -548094 2.1 HDGF SMAD1 ARNT ARID4B SIN3A FEZF1 ZNF2 POLR2B E2F8 ZNF207 FAM222B RAB34 TRAF4 SARM1 RPL23A TAOK1 GIT1 ENSG00000264138 ENSG00000238516
GH17I029743 Enhancer 1.4 Ensembl ENCODE dbSUPER 9.7 +354.4 354368 1.8 FOXA2 SIN3A FEZF1 ZNF2 YY1 SLC30A9 ZNF213 ZNF302 KLF13 ZNF662 GOSR1 LRRC37BP1 SH3GL1P2 SUZ12P1 SMURF2P1 CORO6 NUFIP2 TBC1D29 ENSG00000264290 LOC101927018
GH17I029450 Enhancer 0.6 ENCODE 12 +59.9 59894 0.2 RXRA REST NFIL3 JUND ZNF366 HNF4G NR2C1 HNF4A RXRB RNU6-711P TAOK1 RNU4-34P RNU6-1034P GC17P029533
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around TAOK1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the TAOK1 gene promoter:

Genomic Locations for TAOK1 Gene

Genomic Locations for TAOK1 Gene
chr17:29,390,464-29,551,904
(GRCh38/hg38)
Size:
161,441 bases
Orientation:
Plus strand
chr17:27,717,482-27,878,922
(GRCh37/hg19)

Genomic View for TAOK1 Gene

Genes around TAOK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TAOK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TAOK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TAOK1 Gene

Proteins for TAOK1 Gene

  • Protein details for TAOK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q7L7X3-TAOK1_HUMAN
    Recommended name:
    Serine/threonine-protein kinase TAO1
    Protein Accession:
    Q7L7X3
    Secondary Accessions:
    • A2RUT8
    • B7ZLV6
    • Q96L75
    • Q9H2K7
    • Q9H7S5
    • Q9P2I6

    Protein attributes for TAOK1 Gene

    Size:
    1001 amino acids
    Molecular mass:
    116070 Da
    Quaternary structure:
    • Self-associates. Interacts with MAP2K3 (By similarity). Interacts with SPRED1 and TESK1. Interacts with MAP3K7.
    SequenceCaution:
    • Sequence=BAA92599.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Alternative splice isoforms for TAOK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for TAOK1 Gene

Selected DME Specific Peptides for TAOK1 Gene

Q7L7X3:
  • DIKAGNIL
  • KKMSYSGKQ
  • ELLNAYQSKIK
  • LQHQTEL
  • LENKLKAEMDEHRLRLDKDLETQRNNF
  • DEAQEAECQ
  • QALRLDE
  • LEQRVSL
  • THGALQGLAYLHSH
  • WSHNPTGG
  • TCKIQTRQYKALR
  • QIKKQFQ
  • QEHEQDS
  • FVLRERP
  • EIGHGSFGAVYFA
  • LECRRFKRRMLL
  • ENQSTPK
  • YDGKVDV
  • EKWQDIIKEV
  • WSLGITCIELAER
  • RKEQLKEEL
  • VKLADFG
  • QTQKDLE
  • QELEFRHL
  • EYKGCYL
  • KAGNILL
  • ERIRSLLERQAREIEAFD
  • ERELRRK
  • SPPQVSRHKSHYRNREHFATIRTASLVTRQ
  • MNAMSALYHIAQN
  • SGYKRMRRQHQKQL
  • HRDIKAGN
  • WMAPEVI
  • QHFQAEEEANLLRRQRQYL
  • SRSTSVTSQ
  • EQTRKLAILAEQY
  • SDDKSELDMMEGDHTVMSNSSVIHLKPEEENY
  • LKDPEIAELFFKEDPE
  • IEEEMLALQ
  • EWSDYFRNFVDSCL
  • HLLETTPK
  • GSNQSIPSMSISASSQSSSV
  • EKKFQQHIQAQQKKELN
  • GTPYWMAPE
  • VLIDLIQRTKDAVRELDNLQYRKMKK
  • NQLEYNKRRE

Post-translational modifications for TAOK1 Gene

  • Autophosphorylated (By similarity). Phosphorylated by ATM in response to DNA damage. Phosphorylated by LRRK2.
  • Proteolytically processed by caspase-3 (CASP3).

Other Protein References for TAOK1 Gene

Domains & Families for TAOK1 Gene

Gene Families for TAOK1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for TAOK1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q7L7X3

UniProtKB/Swiss-Prot:

TAOK1_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with TAOK1: view

Function for TAOK1 Gene

Molecular function for TAOK1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Serine/threonine-protein kinase activity is inhibited by SPRED1.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating Thr-208 of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
UniProtKB/Swiss-Prot Induction:
In response to DNA damage.

Enzyme Numbers (IUBMB) for TAOK1 Gene

Phenotypes From GWAS Catalog for TAOK1 Gene

Gene Ontology (GO) - Molecular Function for TAOK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity ISS,NAS 14517247
GO:0004674 protein serine/threonine kinase activity NAS 14517247
GO:0004709 MAP kinase kinase kinase activity IBA --
GO:0005515 protein binding IPI 11733138
genes like me logo Genes that share ontologies with TAOK1: view
genes like me logo Genes that share phenotypes with TAOK1: view

Animal Model Products

CRISPR Products

miRNA for TAOK1 Gene

miRTarBase miRNAs that target TAOK1

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TAOK1 Gene

Localization for TAOK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TAOK1 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TAOK1 gene
Compartment Confidence
extracellular 5
cytosol 5
nucleus 3
cytoskeleton 2

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for TAOK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IBA --
GO:0005829 cytosol TAS --
GO:0070062 extracellular exosome HDA,IDA 19056867
genes like me logo Genes that share ontologies with TAOK1: view

Pathways & Interactions for TAOK1 Gene

genes like me logo Genes that share pathways with TAOK1: view

Pathways by source for TAOK1 Gene

1 KEGG pathway for TAOK1 Gene

SIGNOR curated interactions for TAOK1 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for TAOK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000186 activation of MAPKK activity IEA --
GO:0000187 activation of MAPK activity TAS 22683681
GO:0006281 DNA repair IEA --
GO:0006468 protein phosphorylation NAS 14517247
GO:0006915 apoptotic process IEA --
genes like me logo Genes that share ontologies with TAOK1: view

Drugs & Compounds for TAOK1 Gene

(1) Drugs for TAOK1 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for TAOK1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with TAOK1: view

Transcripts for TAOK1 Gene

Unigene Clusters for TAOK1 Gene

TAO kinase 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for TAOK1 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9a · 9b ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^
SP1: - - -
SP2: - - -
SP3:
SP4: -

ExUns: 22
SP1:
SP2:
SP3:
SP4:

Relevant External Links for TAOK1 Gene

GeneLoc Exon Structure for
TAOK1
ECgene alternative splicing isoforms for
TAOK1

Expression for TAOK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for TAOK1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for TAOK1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (35.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TAOK1 Gene



Protein tissue co-expression partners for TAOK1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of TAOK1 Gene:

TAOK1

SOURCE GeneReport for Unigene cluster for TAOK1 Gene:

Hs.597434

mRNA Expression by UniProt/SwissProt for TAOK1 Gene:

Q7L7X3-TAOK1_HUMAN
Tissue specificity: Highly expressed in the testis, and to a lower extent also expressed in brain, placenta, colon and skeletal muscle.

Evidence on tissue expression from TISSUES for TAOK1 Gene

  • Nervous system(4.8)
  • Blood(4.3)
  • Liver(4.3)
  • Lung(2.3)
genes like me logo Genes that share expression patterns with TAOK1: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TAOK1 Gene

Orthologs for TAOK1 Gene

This gene was present in the common ancestor of animals.

Orthologs for TAOK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia TAOK1 33 34
  • 99.83 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia TAOK1 34
  • 99 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia TAOK1 34
  • 98 (a)
OneToOne
dog
(Canis familiaris)
Mammalia TAOK1 33 34
  • 95.6 (n)
cow
(Bos Taurus)
Mammalia TAOK1 33 34
  • 95.24 (n)
rat
(Rattus norvegicus)
Mammalia Taok1 33
  • 93.54 (n)
mouse
(Mus musculus)
Mammalia Taok1 33 16 34
  • 93.27 (n)
chicken
(Gallus gallus)
Aves TAOK1 33 34
  • 87.15 (n)
lizard
(Anolis carolinensis)
Reptilia TAOK1 34
  • 95 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia taok1 33
  • 83.15 (n)
Str.6620 33
African clawed frog
(Xenopus laevis)
Amphibia MGC52943 33
zebrafish
(Danio rerio)
Actinopterygii TAOK1 (2 of 3) 34
  • 88 (a)
OneToMany
taok1 34
  • 84 (a)
OneToMany
CU929119.2 34
  • 81 (a)
OneToMany
LOC100004576 33
  • 73.57 (n)
fruit fly
(Drosophila melanogaster)
Insecta Tao 33 34
  • 57.93 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003202 33
  • 57.78 (n)
worm
(Caenorhabditis elegans)
Secernentea kin-18 33 34
  • 51.42 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 49 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.8830 33
Species where no ortholog for TAOK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for TAOK1 Gene

ENSEMBL:
Gene Tree for TAOK1 (if available)
TreeFam:
Gene Tree for TAOK1 (if available)

Paralogs for TAOK1 Gene

Paralogs for TAOK1 Gene

(8) SIMAP similar genes for TAOK1 Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with TAOK1: view

Variants for TAOK1 Gene

Sequence variations from dbSNP and Humsavar for TAOK1 Gene

SNP ID Clin Chr 17 pos Variation AA Info Type
rs1000013501 -- 29,418,288(+) A/G intron_variant
rs1000047173 -- 29,425,133(+) G/A intron_variant
rs1000050318 -- 29,525,382(+) ATTACA/A intron_variant
rs1000065096 -- 29,437,932(+) T/C intron_variant
rs1000068118 -- 29,410,524(+) A/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for TAOK1 Gene

Variant ID Type Subtype PubMed ID
esv22895 CNV loss 19812545
esv2335781 CNV deletion 18987734
esv2474903 CNV deletion 19546169
esv2658989 CNV deletion 23128226
esv2673792 CNV deletion 23128226
esv2715797 CNV deletion 23290073
esv3303028 CNV tandem duplication 20981092
esv3405501 CNV insertion 20981092
esv3582597 CNV loss 25503493
esv3640327 CNV loss 21293372
esv994280 OTHER inversion 20482838
nsv1077840 CNV duplication 25765185
nsv819892 CNV loss 19587683
nsv821292 CNV duplication 20802225
nsv827940 CNV gain 20364138
nsv833409 CNV gain 17160897

Variation tolerance for TAOK1 Gene

Residual Variation Intolerance Score: 4.52% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.48; 28.86% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for TAOK1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
TAOK1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TAOK1 Gene

Disorders for TAOK1 Gene

MalaCards: The human disease database

(1) MalaCards diseases for TAOK1 Gene - From: DISEASES

Disorder Aliases PubMed IDs
chromosome 17q11.2 deletion syndrome, 1.4-mb
  • neurofibromatosis 1 microdeletion syndrome
- elite association - COSMIC cancer census association via MalaCards
Search TAOK1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for TAOK1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with TAOK1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for TAOK1 Gene

Publications for TAOK1 Gene

  1. Human TAO kinase 1 induces apoptosis in SH-SY5Y cells. (PMID: 17900936) Wu MF … Wang SG (Cell biology international 2008) 3 4 22 58
  2. A functional genomic screen identifies a role for TAO1 kinase in spindle-checkpoint signalling. (PMID: 17417629) Draviam VM … Elledge SJ (Nature cell biology 2007) 3 4 22 58
  3. MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1. (PMID: 14517247) Timm T … Mandelkow EM (The EMBO journal 2003) 2 3 22 58
  4. Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10718198) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4 58
  5. New gene functions in megakaryopoiesis and platelet formation. (PMID: 22139419) Gieger C … Soranzo N (Nature 2011) 3 44 58

Products for TAOK1 Gene

Sources for TAOK1 Gene

Content
Loading form....