Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PTK2 Gene

Aliases for PTK2 Gene

  • Protein Tyrosine Kinase 2 2 3 5
  • Protein Phosphatase 1 Regulatory Subunit 71 3 4
  • Focal Adhesion Kinase-Related Nonkinase 3 4
  • PTK2 Protein Tyrosine Kinase 2 2 3
  • EC 2.7.10.2 4 61
  • Pp125FAK 3 4
  • PPP1R71 3 4
  • P125FAK 3 4
  • FADK 1 3 4
  • FAK1 3 4
  • FRNK 3 4
  • FAK 3 4
  • Protein Phosphatase 1, Regulatory Subunit 71 2
  • Focal Adhesion Kinase Isoform FAK-Del33 3
  • FAK-Related Non-Kinase Polypeptide 3
  • Protein-Tyrosine Kinase 2 4
  • Focal Adhesion Kinase 1 3
  • EC 2.7.10 61
  • FADK 3

External Ids for PTK2 Gene

Previous GeneCards Identifiers for PTK2 Gene

  • GC08M140557
  • GC08M141856
  • GC08M141352
  • GC08M141639
  • GC08M141737
  • GC08M136979
  • GC08M141667

Summaries for PTK2 Gene

Entrez Gene Summary for PTK2 Gene

  • This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only four of them have been determined. [provided by RefSeq, Oct 2015]

GeneCards Summary for PTK2 Gene

PTK2 (Protein Tyrosine Kinase 2) is a Protein Coding gene. Diseases associated with PTK2 include Glioblastoma Multiforme and Malignant Glioma. Among its related pathways are Development VEGF signaling via VEGFR2 - generic cascades and MAPK-Erk Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is PTK2B.

UniProtKB/Swiss-Prot for PTK2 Gene

  • Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.

Tocris Summary for PTK2 Gene

  • Focal adhesion kinase (FAK), a non-receptor tyrosine kinase, is the first intracellular step in the signal transduction cascade initiated by the attachment of an integrin to the extracellular matrix at points known as focal adhesions. FAK has a key role in cellular migration and motility.

Gene Wiki entry for PTK2 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PTK2 Gene

Genomics for PTK2 Gene

Regulatory Elements for PTK2 Gene

Enhancers for PTK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH08G141037 1.7 FANTOM5 Ensembl ENCODE dbSUPER 13 -36.2 -36162 2.6 ZNF493 SIN3A RAD21 GLIS2 GATA2 SCRT2 SMARCC2 RCOR1 FOS ZNF263 PTK2 DENND3 LOC101927963 LOC105375783 LOC105375784
GH08G140789 1.9 FANTOM5 Ensembl ENCODE dbSUPER 11.5 +211.1 211072 3.7 PKNOX1 ATF1 ARNT FEZF1 BRCA1 YY1 GATA2 FOS DEK ZHX2 AGO2 MIR151A PTK2 TRAPPC9 CHRAC1 ENSG00000279786 GC08M140734
GH08G141034 1.5 Ensembl ENCODE dbSUPER 13 -33.4 -33369 2.5 GLIS2 GATA2 FOS DEK SMARCB1 TBX21 MBD2 SMARCA4 GLIS1 KDM1A PTK2 DENND3 LOC101927963 LOC105375783 LOC105375784
GH08G140954 1 Ensembl ENCODE 17.8 +46.0 46036 2.4 CBX3 TAL1 JUN SIN3A CEBPG ZKSCAN1 CHAMP1 ZNF316 GATA3 GATA2 PTK2 SLC45A4 AGO2 RNA5SP278
GH08G140972 0.9 ENCODE 17.7 +27.6 27621 3.9 FOXA2 MLX ARID4B FEZF1 YY1 PPARG KAT8 MIER3 GLIS1 RCOR2 PTK2 AGO2 RNA5SP278
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PTK2 on UCSC Golden Path with GeneCards custom track

Promoters for PTK2 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000231793 1216 2801 PKNOX1 CREB3L1 ARNT ARID4B SIN3A DMAP1 ZBTB7B ZNF766 FOS KLF13

Genomic Location for PTK2 Gene

Chromosome:
8
Start:
140,657,900 bp from pter
End:
141,002,216 bp from pter
Size:
344,317 bases
Orientation:
Minus strand

Genomic View for PTK2 Gene

Genes around PTK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PTK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PTK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PTK2 Gene

Proteins for PTK2 Gene

  • Protein details for PTK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q05397-FAK1_HUMAN
    Recommended name:
    Focal adhesion kinase 1
    Protein Accession:
    Q05397
    Secondary Accessions:
    • B4E2N6
    • F5H4S4
    • J3QT16
    • Q14291
    • Q8IYN9
    • Q9UD85

    Protein attributes for PTK2 Gene

    Size:
    1052 amino acids
    Molecular mass:
    119233 Da
    Quaternary structure:
    • Interacts (via first Pro-rich region) with CAS family members (via SH3 domain), including BCAR1, BCAR3, CASS4 and NEDD9. Interacts with GIT1. Interacts with SORBS1. Interacts with ARHGEF28. Interacts with SHB. Interacts with PXN and TLN1. Interacts with STAT1. Interacts with DCC. Interacts with WASL. Interacts with ARHGEF7. Interacts with GRB2 and GRB7 (By similarity). Component of a complex that contains at least FER, CTTN and PTK2/FAK1. Interacts with BMX. Interacts with TGFB1I1. Interacts with STEAP4. Interacts with ZFYVE21. Interacts with ESR1. Interacts with PIK3R1 or PIK3R2. Interacts with SRC, FGR, FLT4 and RET. Interacts with EPHA2 in resting cells; activation of EPHA2 recruits PTPN11, leading to dephosphorylation of PTK2/FAK1 and dissociation of the complex. Interacts with EPHA1 (kinase activity-dependent). Interacts with CD4; this interaction requires the presence of HIV-1 gp120. Interacts with PIAS1. Interacts with ARHGAP26 and SHC1. Interacts with RB1CC1; this inhibits PTK2/FAK1 activity and activation of downstream signaling pathways. Interacts with P53/TP53 and MDM2. Interacts with LPXN (via LD motif 3). Interacts with MISP. Interacts with CIB1 isoform 2. Interacts with CD36. Interacts with EMP2; regulates PTK2 activation and localization (PubMed:19494199).

    Three dimensional structures from OCA and Proteopedia for PTK2 Gene

    Alternative splice isoforms for PTK2 Gene

neXtProt entry for PTK2 Gene

Selected DME Specific Peptides for PTK2 Gene

Q05397:
  • SEEVHWLH
  • HPPEEWKYELRIRYLPKGF
  • GVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKC
  • VCMWEIL
  • DKECFKCALGSSWIISVELAIGPEEGISYLTDKG
  • GNQHIYQPVGKPD
  • SEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDG
  • QQEERMRMESRRQ
  • APPKKPPRPGAP
  • AARNVLV
  • NQFTEDKPTLNFFYQQVK
  • PESINFRRFT
  • AVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGV
  • CVKLGDFGLSRY
  • IQPAPPEEYVPMVK
  • ETDDYAEIIDEEDTYTMPS
  • NDKVYENVTGLVKAVIEMSS
  • IRHGDATDVRGIIQKIVDSHKVK
  • QVQTIQYS
  • EMRGNALEKKSNYEVLEKDVGL
  • LPASTHREIEMAQKLLNSDL
  • AENMADLIDGYCRL
  • TVSWDSGGSDEAPPKPSRPGYPSPRSSEGF
  • PTANLDR

Post-translational modifications for PTK2 Gene

  • Phosphorylated on tyrosine residues upon activation, e.g. upon integrin signaling. Tyr-397 is the major autophosphorylation site, but other kinases can also phosphorylate this residue. Phosphorylation at Tyr-397 promotes interaction with SRC and SRC family members, leading to phosphorylation at Tyr-576, Tyr-577 and at additional tyrosine residues. FGR promotes phosphorylation at Tyr-397 and Tyr-576. FER promotes phosphorylation at Tyr-577, Tyr-861 and Tyr-925, even when cells are not adherent. Tyr-397, Tyr-576 and Ser-722 are phosphorylated only when cells are adherent. Phosphorylation at Tyr-397 is important for interaction with BMX, PIK3R1 and SHC1. Phosphorylation at Tyr-925 is important for interaction with GRB2. Dephosphorylated by PTPN11; PTPN11 is recruited to PTK2 via EPHA2 (tyrosine phosphorylated). Microtubule-induced dephosphorylation at Tyr-397 is crucial for the induction of focal adhesion disassembly; this dephosphorylation could be catalyzed by PTPN11 and regulated by ZFYVE21.
  • Sumoylated; this enhances autophosphorylation.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for PTK2 (FAK)

Assay Products

  • Cloud-Clone Corp. Assay Kits for PTK2

Domains & Families for PTK2 Gene

Graphical View of Domain Structure for InterPro Entry

Q05397

UniProtKB/Swiss-Prot:

FAK1_HUMAN :
  • The Pro-rich regions interact with the SH3 domain of CAS family members, such as BCAR1 and NEDD9, and with the GTPase activating protein ARHGAP26.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily.
Domain:
  • The Pro-rich regions interact with the SH3 domain of CAS family members, such as BCAR1 and NEDD9, and with the GTPase activating protein ARHGAP26.
  • The carboxy-terminal region is the site of focal adhesion targeting (FAT) sequence which mediates the localization of FAK1 to focal adhesions.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily.
genes like me logo Genes that share domains with PTK2: view

Function for PTK2 Gene

Molecular function for PTK2 Gene

GENATLAS Biochemistry:
focal adhesion kinase 1,pp125FAK,widely expressed in T and B lymphocytes,with a splice variant,FAK1A,expressed in brain,primary mediator of integrin signaling after integrin mediated cell adhesion and FAK phosphorylation,also mediating a direct interaction with the C terminal SH2 domain of phospholipase C (PCLG1)
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Subject to autoinhibition, mediated by interactions between the FERM domain and the kinase domain. Activated by autophosphorylation at Tyr-397. This promotes interaction with SRC and phosphorylation at Tyr-576 and Tyr-577 in the kinase activation loop. Phosphorylation at Tyr-576 and Tyr-577 is required for maximal kinase activity. Inhibited by TAC544, TAE226, PF-573,228 and PF-562,271.
UniProtKB/Swiss-Prot Function:
Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.

Enzyme Numbers (IUBMB) for PTK2 Gene

Gene Ontology (GO) - Molecular Function for PTK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003779 actin binding IDA 16803572
GO:0004672 protein kinase activity TAS --
GO:0004713 protein tyrosine kinase activity TAS --
GO:0004715 non-membrane spanning protein tyrosine kinase activity IDA,IEA 10655584
genes like me logo Genes that share ontologies with PTK2: view
genes like me logo Genes that share phenotypes with PTK2: view

Animal Models for PTK2 Gene

MGI Knock Outs for PTK2:

Animal Model Products

  • Taconic Biosciences Mouse Models for PTK2

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for PTK2
  • Applied Biological Materials Clones for PTK2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PTK2 Gene

Localization for PTK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PTK2 Gene

Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Note=Constituent of focal adhesions. Detected at microtubules.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PTK2 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
nucleus 5
cytosol 5
extracellular 3
mitochondrion 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for PTK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001725 stress fiber IDA 24036928
GO:0005634 nucleus IEA,IDA 15855171
GO:0005737 cytoplasm IEA,IDA 21637765
GO:0005815 microtubule organizing center IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with PTK2: view

Pathways & Interactions for PTK2 Gene

SuperPathway Contained pathways
1 RET signaling
2 ERK Signaling
3 Integrin Pathway
4 Focal Adhesion
5 EPH-Ephrin signaling
genes like me logo Genes that share pathways with PTK2: view

Pathways by source for PTK2 Gene

SIGNOR curated interactions for PTK2 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for PTK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade TAS --
GO:0000226 microtubule cytoskeleton organization IEA --
GO:0001525 angiogenesis TAS 20552554
GO:0001568 blood vessel development IEA --
GO:0001570 vasculogenesis IEA --
genes like me logo Genes that share ontologies with PTK2: view

Drugs & Compounds for PTK2 Gene

(92) Drugs for PTK2 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
2-({5-CHLORO-2-[(2-METHOXY-4-MORPHOLIN-4-YLPHENYL)AMINO]PYRIMIDIN-4-YL}AMINO)-N-METHYLBENZAMIDE Experimental Pharma Target 0
7-PYRIDIN-2-YL-N-(3,4,5-TRIMETHOXYPHENYL)-7H-PYRROLO[2,3-D]PYRIMIDIN-2-AMINE Experimental Pharma Target 0
Genistein Investigational Pharma Potentiation, Activator AR agonist 58
PF-00562271 Pharma Inhibitor FAK/Pyk2 inhibitor,potent and ATP-competitive, Others 0

(63) Additional Compounds for PTK2 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
LPA(0:0/16:0)
  • 2-Hexadecanoyl-phosphatidic acid
  • 2-Palmitoyl-glycero-3-phosphate
  • LPA(0:0/16:0)
  • LPA(16:0)
  • Lysophosphatidic acid(0:0/16:0)
LPA(0:0/18:0)
  • 2-Octadecanoyl-phosphatidic acid
  • 2-Stearoyl-glycero-3-phosphate
  • LPA(0:0/18:0)
  • LPA(18:0)
  • Lysophosphatidic acid(0:0/18:0)
LPA(0:0/18:1(9Z))
  • 2-(9Z-Octadecenoyl)-phosphatidic acid
  • 2-Oleoyl-glycero-3-phosphate
  • LPA(0:0/18:1)
  • LPA(0:0/18:1n9)
  • LPA(0:0/18:1w9)
LPA(0:0/18:2(9Z,12Z))
  • 2-(9Z,12Z-Octadecadienoyl)-phosphatidic acid
  • 2-Linoleoyl-glycero-3-phosphate
  • LPA(0:0/18:2)
  • LPA(0:0/18:2n6)
  • LPA(0:0/18:2w6)

(4) Tocris Compounds for PTK2 Gene

Compound Action Cas Number
FAK Inhibitor 14 Selective FAK inhibitor 4506-66-5
PF 431396 Dual FAK/PYK2 inhibitor 717906-29-1
PF 573228 Potent and selective FAK inhibitor 869288-64-2
Y 11 Potent and selective FAK inhibitor 1086639-59-9

(12) ApexBio Compounds for PTK2 Gene

Compound Action Cas Number
CEP-37440 FAK/ALK inhibitor,potent and selective 1391712-60-9
Defactinib 1073154-85-4
FAK Inhibitor 14 4506-66-5
Genistein AR agonist 446-72-0
PF-00562271 FAK/Pyk2 inhibitor,potent and ATP-competitive 939791-38-5
PF-431396 Pyk2 and FAK inhibitor 717906-29-1
PF-562271 ATP-competitive FAK inhibitor, reversible 717907-75-0
PF-562271 HCl FAK/Pyk2 inhibitor
PF-573228 ATP-competitive FAK inhibitor 869288-64-2
PND-1186 Potent FAK inhibitor 1061353-68-1
TAE226 (NVP-TAE226) FAK inhibitor,potent and ATP-competitive 761437-28-9
Y 11 1086639-59-9
genes like me logo Genes that share compounds with PTK2: view

Drug Products

Transcripts for PTK2 Gene

Unigene Clusters for PTK2 Gene

Protein tyrosine kinase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for PTK2
  • Applied Biological Materials Clones for PTK2

Alternative Splicing Database (ASD) splice patterns (SP) for PTK2 Gene

ExUns: 1 ^ 2a · 2b · 2c ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7a · 7b · 7c · 7d ^ 8 ^ 9a · 9b ^ 10a · 10b · 10c · 10d ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^
SP1: - - - - - - - - - - -
SP2: - -
SP3:
SP4:
SP5:
SP6:
SP7: - - - - - - -
SP8: - - -
SP9: - - - - -
SP10:
SP11:
SP12: - - - - - - - - - - - -
SP13: - - -
SP14: - - - - - - - - - - -
SP15:
SP16:
SP17: - -
SP18:
SP19:
SP20:
SP21:
SP22: -

ExUns: 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b ^ 22 ^ 23 ^ 24 ^ 25a · 25b ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b ^ 32 ^ 33a · 33b ^ 34a · 34b ^ 35 ^ 36a ·
SP1: - - - - - -
SP2: - - - - - - - -
SP3: - - - - - -
SP4: - - - - -
SP5: -
SP6: - - -
SP7:
SP8:
SP9:
SP10: -
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18: - -
SP19:
SP20:
SP21:
SP22:

ExUns: 36b ^ 37 ^ 38a · 38b · 38c ^ 39 ^ 40 ^ 41 ^ 42a · 42b · 42c
SP1: - - -
SP2: - - -
SP3: - - -
SP4: - - -
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15: - -
SP16:
SP17:
SP18:
SP19:
SP20: - - -
SP21: -
SP22:

Relevant External Links for PTK2 Gene

GeneLoc Exon Structure for
PTK2
ECgene alternative splicing isoforms for
PTK2

Expression for PTK2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PTK2 Gene

Protein differential expression in normal tissues from HIPED for PTK2 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (20.9) and Platelet (7.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PTK2 Gene



Protein tissue co-expression partners for PTK2 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PTK2 Gene:

PTK2

SOURCE GeneReport for Unigene cluster for PTK2 Gene:

Hs.395482

mRNA Expression by UniProt/SwissProt for PTK2 Gene:

Q05397-FAK1_HUMAN
Tissue specificity: Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous.

Evidence on tissue expression from TISSUES for PTK2 Gene

  • Nervous system(5)
  • Blood(4.5)
  • Skin(4.5)
  • Intestine(3.6)
  • Lung(3.3)
  • Heart(3)
  • Kidney(3)
  • Muscle(2.7)
  • Liver(2.1)
  • Lymph node(2.1)
  • Pancreas(2.1)
  • Thyroid gland(2.1)
genes like me logo Genes that share expression patterns with PTK2: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for PTK2 Gene

Orthologs for PTK2 Gene

This gene was present in the common ancestor of animals.

Orthologs for PTK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PTK2 34 35
  • 99.66 (n)
dog
(Canis familiaris)
Mammalia PTK2 34 35
  • 91.72 (n)
rat
(Rattus norvegicus)
Mammalia Ptk2 34
  • 90.87 (n)
mouse
(Mus musculus)
Mammalia Ptk2 34 16 35
  • 90.75 (n)
cow
(Bos Taurus)
Mammalia PTK2 34 35
  • 88.43 (n)
oppossum
(Monodelphis domestica)
Mammalia PTK2 35
  • 87 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PTK2 35
  • 85 (a)
OneToOne
chicken
(Gallus gallus)
Aves PTK2 34 35
  • 83.86 (n)
lizard
(Anolis carolinensis)
Reptilia PTK2 35
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ptk2 34
  • 78.27 (n)
Str.16767 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.6819 34
zebrafish
(Danio rerio)
Actinopterygii ptk2ab 34
  • 74.12 (n)
ptk2.2 35
  • 59 (a)
OneToOne
ptk2 34
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.4722 34
fruit fly
(Drosophila melanogaster)
Insecta Fak 34
  • 48.81 (n)
Fak56D 36 35
  • 37 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP011118 34
  • 48.4 (n)
worm
(Caenorhabditis elegans)
Secernentea kin-32 36 34 35
  • 48.08 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.5720 35
  • 46 (a)
OneToMany
Species where no ortholog for PTK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PTK2 Gene

ENSEMBL:
Gene Tree for PTK2 (if available)
TreeFam:
Gene Tree for PTK2 (if available)

Paralogs for PTK2 Gene

Paralogs for PTK2 Gene

genes like me logo Genes that share paralogs with PTK2: view

Variants for PTK2 Gene

Sequence variations from dbSNP and Humsavar for PTK2 Gene

SNP ID Clin Chr 08 pos Sequence Context AA Info Type
VAR_041684 A glioblastoma multiforme sample
VAR_041686 A metastatic melanoma sample
rs1000004403 -- 140,751,778(+) TGAGC(A/T)ACCGT intron-variant
rs1000005223 -- 140,850,110(+) AAAGA(C/T)TTCTG intron-variant
rs1000006469 -- 140,918,684(+) ATAGT(A/C)TGCTC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PTK2 Gene

Variant ID Type Subtype PubMed ID
dgv1425e214 CNV loss 21293372
dgv3916n106 CNV deletion 24896259
esv1325604 CNV insertion 17803354
esv1765152 CNV insertion 17803354
esv23036 CNV gain 19812545
esv2422061 CNV duplication 20811451
esv2665041 CNV deletion 23128226
esv2670372 CNV deletion 23128226
esv2737756 CNV deletion 23290073
esv2863568 CNV insertion 24192839
esv3573022 CNV loss 25503493
esv3573023 CNV loss 25503493
esv3619038 CNV loss 21293372
esv3619040 CNV loss 21293372
esv3619041 CNV loss 21293372
esv3619042 CNV loss 21293372
esv3619043 CNV loss 21293372
esv3619046 CNV gain 21293372
esv3619047 CNV loss 21293372
esv3619048 CNV gain 21293372
nsv1021888 CNV gain 25217958
nsv1025478 CNV gain 25217958
nsv1031796 CNV gain 25217958
nsv1075175 CNV deletion 25765185
nsv1126125 CNV deletion 24896259
nsv1133698 CNV deletion 24896259
nsv438084 CNV loss 16468122
nsv465952 CNV loss 19166990
nsv472837 CNV novel sequence insertion 20440878
nsv524300 CNV gain 19592680
nsv526444 CNV gain 19592680
nsv612568 CNV gain 21841781
nsv612569 CNV loss 21841781
nsv612571 CNV loss 21841781
nsv831482 CNV loss 17160897
nsv8392 CNV gain 18304495

Variation tolerance for PTK2 Gene

Residual Variation Intolerance Score: 4.99% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.49; 29.04% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PTK2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PTK2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PTK2 Gene

Disorders for PTK2 Gene

MalaCards: The human disease database

(13) MalaCards diseases for PTK2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
glioblastoma multiforme
  • adult glioblastoma multiforme
malignant glioma
glioblastoma
  • glioblastoma multiforme
glioma
lung cancer
  • lung cancer, protection against
- elite association - COSMIC cancer census association via MalaCards
Search PTK2 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

FAK1_HUMAN
  • Note=Aberrant PTK2/FAK1 expression may play a role in cancer cell proliferation, migration and invasion, in tumor formation and metastasis. PTK2/FAK1 overexpression is seen in many types of cancer.

Relevant External Links for PTK2

Genetic Association Database (GAD)
PTK2
Human Genome Epidemiology (HuGE) Navigator
PTK2
Tumor Gene Database (TGDB):
PTK2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PTK2
genes like me logo Genes that share disorders with PTK2: view

No data available for Genatlas for PTK2 Gene

Publications for PTK2 Gene

  1. Nuclear FAK promotes cell proliferation and survival through FERM- enhanced p53 degradation. (PMID: 18206965) Lim S.T. … Ilic D. (Mol. Cell 2008) 3 4 22 64
  2. Activation of FAK is necessary for the osteogenic differentiation of human mesenchymal stem cells on laminin-5. (PMID: 16927379) Salasznyk R.M. … Plopper G.E. (J. Cell. Biochem. 2007) 3 4 22 64
  3. Microtubule-induced focal adhesion disassembly is mediated by dynamin and focal adhesion kinase. (PMID: 15895076) Ezratty E.J. … Gundersen G.G. (Nat. Cell Biol. 2005) 3 4 22 64
  4. Direct interaction of the N-terminal domain of focal adhesion kinase with the N-terminal transactivation domain of p53. (PMID: 15855171) Golubovskaya V.M. … Cance W.G. (J. Biol. Chem. 2005) 3 4 22 64
  5. Focal adhesion kinase is upstream of phosphatidylinositol 3- kinase/Akt in regulating fibroblast survival in response to contraction of type I collagen matrices via a beta 1 integrin viability signaling pathway. (PMID: 15166238) Xia H. … Henke C.A. (J. Biol. Chem. 2004) 3 4 22 64

Products for PTK2 Gene