Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAPK6 Gene

Aliases for MAPK6 Gene

  • Mitogen-Activated Protein Kinase 6 2 3 5
  • Extracellular Signal-Regulated Kinase 3 3 4
  • MAP Kinase Isoform P97 3 4
  • MAP Kinase 6 3 4
  • EC 2.7.11.24 4 61
  • P97-MAPK 3 4
  • MAPK 6 3 4
  • PRKM6 3 4
  • ERK-3 3 4
  • ERK3 3 4
  • Extracellular Signal-Regulated Kinase, P97 3
  • Protein Kinase, Mitogen-Activated 5 3
  • Protein Kinase, Mitogen-Activated 6 3
  • EC 2.7.11 61
  • HsT17250 3
  • P97MAPK 3

External Ids for MAPK6 Gene

Previous HGNC Symbols for MAPK6 Gene

  • PRKM6

Previous GeneCards Identifiers for MAPK6 Gene

  • GC15P047869
  • GC15P045358
  • GC15P049890
  • GC15P050027
  • GC15P050098
  • GC15P052311
  • GC15P029169

Summaries for MAPK6 Gene

Entrez Gene Summary for MAPK6 Gene

  • The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq, Jul 2008]

GeneCards Summary for MAPK6 Gene

MAPK6 (Mitogen-Activated Protein Kinase 6) is a Protein Coding gene. Diseases associated with MAPK6 include Pulmonary Immaturity. Among its related pathways are CCR5 Pathway in Macrophages and mTOR Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAPK4.

UniProtKB/Swiss-Prot for MAPK6 Gene

  • Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).

Gene Wiki entry for MAPK6 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAPK6 Gene

Genomics for MAPK6 Gene

Regulatory Elements for MAPK6 Gene

Enhancers for MAPK6 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH15G052099 1.9 FANTOM5 Ensembl ENCODE dbSUPER 26.3 +150.0 150004 5.5 HDGF PKNOX1 ATF1 MLX WRNIP1 SIN3A YY1 ZNF121 GATA2 ZNF207 MAPK6 GNB5 DMXL2 TMOD3 ENSG00000259712 BCL2L10
GH15G052092 1.7 FANTOM5 Ensembl ENCODE dbSUPER 16.5 +142.6 142573 4.2 TBP PKNOX1 SIN3A RAD21 BRCA1 ZBTB40 RFX5 GATA2 RCOR1 FOS MAPK6 LEO1 GNB5 ENSG00000259178 LYSMD2 ENSG00000259709 MYO5C DMXL2 ENSG00000259241 RPS13P8
GH15G052076 1.8 FANTOM5 Ensembl ENCODE dbSUPER 13.4 +126.4 126391 4.7 PKNOX1 ARID4B DMAP1 YBX1 ZNF48 YY1 TCF12 ZNF143 FOS SP5 MAPK6 BCL2L10 LYSMD2 GNB5 ENSG00000259178 DMXL2 ENSG00000259398
GH15G051994 1.5 Ensembl ENCODE dbSUPER 12.8 +43.2 43174 2.0 HDGF PKNOX1 FOXA2 MLX ARID4B SIN3A DMAP1 ZNF48 ZBTB7B YY1 MAPK6 LEO1 GNB5 ENSG00000259178 GC15P052002
GH15G051980 1.5 Ensembl ENCODE dbSUPER 12.7 +30.0 29973 2.4 ATF1 CREB3L1 ARNT SIN3A ZNF48 GATA2 ZNF143 DEK ZHX2 MXD4 LYSMD2 MAPK6 TMOD3 GNB5 ENSG00000259178 LEO1 GC15P052002
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MAPK6 on UCSC Golden Path with GeneCards custom track

Genomic Location for MAPK6 Gene

Chromosome:
15
Start:
51,952,106 bp from pter
End:
52,067,372 bp from pter
Size:
115,267 bases
Orientation:
Plus strand

Genomic View for MAPK6 Gene

Genes around MAPK6 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAPK6 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAPK6 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAPK6 Gene

Proteins for MAPK6 Gene

  • Protein details for MAPK6 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q16659-MK06_HUMAN
    Recommended name:
    Mitogen-activated protein kinase 6
    Protein Accession:
    Q16659
    Secondary Accessions:
    • B2R945
    • B5BU65
    • Q68DH4
    • Q8IYN8

    Protein attributes for MAPK6 Gene

    Size:
    721 amino acids
    Molecular mass:
    82681 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Heterodimer with ERK4/MAPK4. Interacts with (via FRIEDE motif) MAPKAPK5 (By similarity). Interacts with UBE3A; this interaction may be indirect and mediated by HERC2, possibly via HERC2 interaction with NEURL4.

    Three dimensional structures from OCA and Proteopedia for MAPK6 Gene

neXtProt entry for MAPK6 Gene

Selected DME Specific Peptides for MAPK6 Gene

Q16659:
  • DPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDT
  • GLKYIHSA
  • HSHIYNWERYH
  • GCIFAEM
  • LSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCI
  • YIVQEYMETDLA
  • LFAGAHELEQMQLIL
  • HSANVLHRDL
  • LKYIHSA
  • QLLRGLKY
  • RVAIKKI
  • VLHRDLK
  • NGLVKAQIALEEASQQL
  • TEDLVLKIGDFGLARI
  • KHALREIKIIRRLDHDNIVKV
  • LKIGDFG
  • VDKLNDLNSSVSQ
  • PMDRLTAE

Post-translational modifications for MAPK6 Gene

  • Phosphorylated at Ser-189 by PAK1, PAK2 and PAK3 resulting in catalytic activation. Phosphorylated by MAPKAPK5 at other sites.
  • Ubiquitination at Met-1 leads to degradation by the proteasome pathway.
  • Ubiquitination at posLast=447447, posLast=471471, Lys480, posLast=517517, Lys563, Lys631, posLast=672672, Lys691, and posLast=703703
  • Modification sites at PhosphoSitePlus

Other Protein References for MAPK6 Gene

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for MAPK6 (ERK3)

Domains & Families for MAPK6 Gene

Suggested Antigen Peptide Sequences for MAPK6 Gene

Graphical View of Domain Structure for InterPro Entry

Q16659

UniProtKB/Swiss-Prot:

MK06_HUMAN :
  • In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Domain:
  • In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
genes like me logo Genes that share domains with MAPK6: view

Function for MAPK6 Gene

Molecular function for MAPK6 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation at Ser-189.
UniProtKB/Swiss-Prot Function:
Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).

Enzyme Numbers (IUBMB) for MAPK6 Gene

Gene Ontology (GO) - Molecular Function for MAPK6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS --
GO:0004707 MAP kinase activity ISS,IBA --
GO:0005515 protein binding IPI 20936779
genes like me logo Genes that share ontologies with MAPK6: view
genes like me logo Genes that share phenotypes with MAPK6: view

Animal Models for MAPK6 Gene

MGI Knock Outs for MAPK6:

Animal Model Products

CRISPR Products

miRNA for MAPK6 Gene

miRTarBase miRNAs that target MAPK6

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MAPK6

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAPK6 Gene

Localization for MAPK6 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAPK6 Gene

Cytoplasm. Nucleus. Note=Translocates to the cytoplasm following interaction with MAPKAPK5. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAPK6 gene
Compartment Confidence
nucleus 5
cytosol 5
cytoskeleton 3

Gene Ontology (GO) - Cellular Components for MAPK6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA,ISS --
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IBA,ISS --
GO:0005829 cytosol TAS --
GO:0032156 septin cytoskeleton IEA --
genes like me logo Genes that share ontologies with MAPK6: view

Pathways & Interactions for MAPK6 Gene

genes like me logo Genes that share pathways with MAPK6: view

SIGNOR curated interactions for MAPK6 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for MAPK6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade IEA --
GO:0006468 protein phosphorylation ISS,TAS --
GO:0007049 cell cycle IEA --
GO:0007165 signal transduction TAS 2032290
GO:0010468 regulation of gene expression IBA --
genes like me logo Genes that share ontologies with MAPK6: view

Drugs & Compounds for MAPK6 Gene

(5) Drugs for MAPK6 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
FR 180204 Pharma ERK inhibitor, Selective ERK inhibitor 0
Magnesium Nutra 0

(1) Additional Compounds for MAPK6 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for MAPK6 Gene

Compound Action Cas Number
FR 180204 ERK inhibitor 865362-74-9
genes like me logo Genes that share compounds with MAPK6: view

Transcripts for MAPK6 Gene

Unigene Clusters for MAPK6 Gene

Mitogen-activated protein kinase 6:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MAPK6

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for MAPK6 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5a · 5b · 5c · 5d ^ 6 ^ 7 ^ 8 ^ 9
SP1: - - -
SP2: - -
SP3: - -
SP4: -

Relevant External Links for MAPK6 Gene

GeneLoc Exon Structure for
MAPK6
ECgene alternative splicing isoforms for
MAPK6

Expression for MAPK6 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAPK6 Gene

Protein differential expression in normal tissues from HIPED for MAPK6 Gene

This gene is overexpressed in Brain (37.6), Monocytes (18.1), and Heart (13.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAPK6 Gene



Protein tissue co-expression partners for MAPK6 Gene

NURSA nuclear receptor signaling pathways regulating expression of MAPK6 Gene:

MAPK6

SOURCE GeneReport for Unigene cluster for MAPK6 Gene:

Hs.411847

mRNA Expression by UniProt/SwissProt for MAPK6 Gene:

Q16659-MK06_HUMAN
Tissue specificity: Highest expression in the skeletal muscle, followed by the brain. Also found in heart, placenta, lung, liver, pancreas, kidney and skin fibroblasts.

Evidence on tissue expression from TISSUES for MAPK6 Gene

  • Muscle(4.4)
  • Nervous system(4.4)
genes like me logo Genes that share expression patterns with MAPK6: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAPK6 Gene

Orthologs for MAPK6 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MAPK6 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAPK6 34 35
  • 99.82 (n)
dog
(Canis familiaris)
Mammalia MAPK6 34 35
  • 96.35 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 35
  • 96 (a)
OneToMany
-- 35
  • 96 (a)
OneToMany
-- 35
  • 96 (a)
OneToMany
cow
(Bos Taurus)
Mammalia MAPK6 34 35
  • 95.79 (n)
mouse
(Mus musculus)
Mammalia Mapk6 34 16 35
  • 88.13 (n)
rat
(Rattus norvegicus)
Mammalia Mapk6 34
  • 87.99 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MAPK6 35
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves MAPK6 34 35
  • 87.41 (n)
lizard
(Anolis carolinensis)
Reptilia MAPK6 35
  • 91 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mapk6 34
  • 80.57 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.23931 34
zebrafish
(Danio rerio)
Actinopterygii mapk6 34 35
  • 69.19 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes FUS3 35
  • 35 (a)
ManyToMany
KSS1 35
  • 35 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.7149 35
  • 22 (a)
OneToMany
Species where no ortholog for MAPK6 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for MAPK6 Gene

ENSEMBL:
Gene Tree for MAPK6 (if available)
TreeFam:
Gene Tree for MAPK6 (if available)

Paralogs for MAPK6 Gene

Paralogs for MAPK6 Gene

(9) SIMAP similar genes for MAPK6 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with MAPK6: view

Variants for MAPK6 Gene

Sequence variations from dbSNP and Humsavar for MAPK6 Gene

SNP ID Clin Chr 15 pos Sequence Context AA Info Type
rs1000053982 -- 52,043,833(+) GGCTC(A/G)CTGCA intron-variant
rs1000123528 -- 52,034,369(+) AGCAC(A/G)ATGGC intron-variant
rs1000160156 -- 52,014,142(+) GTCCC(C/T)GGTTC intron-variant
rs1000169703 -- 52,052,598(+) CACTA(A/T)TCTAC intron-variant
rs1000200218 -- 52,019,301(+) CGCCA(A/G)CACAG intron-variant, upstream-variant-2KB, utr-variant-5-prime

Structural Variations from Database of Genomic Variants (DGV) for MAPK6 Gene

Variant ID Type Subtype PubMed ID
dgv2595n100 CNV gain 25217958
dgv303e201 CNV deletion 23290073
esv2351837 CNV deletion 18987734
esv2749691 CNV deletion 23290073
nsv1039841 CNV gain 25217958
nsv1116073 CNV deletion 24896259
nsv1138369 CNV deletion 24896259
nsv1536 CNV deletion 18451855
nsv471244 CNV gain 18288195
nsv984070 CNV duplication 23825009
nsv984071 CNV duplication 23825009

Variation tolerance for MAPK6 Gene

Residual Variation Intolerance Score: 9.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.72; 57.57% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MAPK6 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAPK6

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAPK6 Gene

Disorders for MAPK6 Gene

MalaCards: The human disease database

(1) MalaCards diseases for MAPK6 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
pulmonary immaturity
  • primary atelectasis of newborn
- elite association - COSMIC cancer census association via MalaCards
Search MAPK6 in MalaCards View complete list of genes associated with diseases

Relevant External Links for MAPK6

Genetic Association Database (GAD)
MAPK6
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MAPK6
genes like me logo Genes that share disorders with MAPK6: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MAPK6 Gene

Publications for MAPK6 Gene

  1. Primary structure, expression and chromosomal locus of a human homolog of rat ERK3. (PMID: 8875998) Meloche S. … Pellerin J. (Oncogene 1996) 2 3 4 22 64
  2. N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome. (PMID: 15226418) Coulombe P. … Meloche S. (Mol. Cell. Biol. 2004) 3 4 22 64
  3. Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes. (PMID: 22645313) Martinez-Noel G. … Howley P.M. (Mol. Cell. Biol. 2012) 3 4 64
  4. Regulation of ERK3/MAPK6 expression by BRAF. (PMID: 16964379) Hoeflich K.P. … Seshagiri S. (Int. J. Oncol. 2006) 3 22 64
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64

Products for MAPK6 Gene

Sources for MAPK6 Gene

Content
Loading form....