Free for academic non-profit institutions. Other users need a Commercial license

Aliases for OGDHL Gene

Aliases for OGDHL Gene

  • Oxoglutarate Dehydrogenase Like 2 3 5
  • 2-Oxoglutarate Dehydrogenase Complex Component E1-Like 3 4
  • Alpha-Ketoglutarate Dehydrogenase-Like 3 4
  • OGDC-E1-Like 3 4
  • 2-Oxoglutarate Dehydrogenase-Like, Mitochondrial 3
  • EC 1.2.4.2 56
  • EC 1.2.4.- 4
  • KIAA1290 4

External Ids for OGDHL Gene

Previous GeneCards Identifiers for OGDHL Gene

  • GC10M050288
  • GC10M050612
  • GC10M050942
  • GC10M045207

Summaries for OGDHL Gene

Entrez Gene Summary for OGDHL Gene

  • The protein encoded by this gene is similar to oxoglutarate dehydrogenase (OGDH) of the OGDH complex, which degrades glucose and glutamate. This gene encodes several isoforms, including some that appear to localize to mitochondria. The encoded protein down-regulates the AKT signaling cascade and can suppress the growth of cervical cancer cells. [provided by RefSeq, Dec 2016]

GeneCards Summary for OGDHL Gene

OGDHL (Oxoglutarate Dehydrogenase Like) is a Protein Coding gene. Among its related pathways are superpathway of tryptophan utilization and Metabolism. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor and oxoglutarate dehydrogenase (succinyl-transferring) activity. An important paralog of this gene is OGDH.

Additional gene information for OGDHL Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for OGDHL Gene

Genomics for OGDHL Gene

GeneHancer (GH) Regulatory Elements for OGDHL Gene

Promoters and enhancers for OGDHL Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH10I049761 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 572.1 +0.2 178 0.8 MLX ZFP64 ARID4B SIN3A SLC30A9 ZNF766 ZNF143 SP3 SP5 NFYC OGDHL LINC00843 AGAP6 ERCC6 WASHC2A RNA5SP317 GC10M049685
GH10I049690 Enhancer 0.5 ENCODE 10.8 +72.0 72009 0.2 SP1 POLR2A POU5F1 EZH2 OGDHL MAPK6PS6 CHAT SLC18A3 C10orf53 GC10M049685
GH10I049689 Enhancer 0.4 ENCODE 10.8 +72.3 72309 0.2 POLR2A EZH2 OGDHL MAPK6PS6 SLC18A3 CHAT GC10M049685 C10orf53
GH10I049701 Enhancer 0.5 ENCODE 6.1 +61.2 61169 0.2 CTCF GLIS1 ZNF341 ZNF143 MZF1 OGDHL GC10M049685 C10orf53
GH10I049734 Enhancer 0.6 ENCODE 0.3 +27.6 27599 0.1 SMARCE1 DPF2 FOXA1 GATA3 JUND CTBP1 FOS TCF7L2 OGDHL GC10M049685
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around OGDHL on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the OGDHL gene promoter:

Genomic Locations for OGDHL Gene

Genomic Locations for OGDHL Gene
chr10:49,734,641-49,762,379
(GRCh38/hg38)
Size:
27,739 bases
Orientation:
Minus strand
chr10:50,942,687-50,970,425
(GRCh37/hg19)

Genomic View for OGDHL Gene

Genes around OGDHL on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OGDHL Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OGDHL Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for OGDHL Gene

Proteins for OGDHL Gene

  • Protein details for OGDHL Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9ULD0-OGDHL_HUMAN
    Recommended name:
    2-oxoglutarate dehydrogenase-like, mitochondrial
    Protein Accession:
    Q9ULD0
    Secondary Accessions:
    • A8K2G1
    • B4DKG2
    • B4E193
    • Q8TAN9
    • Q9NVA0

    Protein attributes for OGDHL Gene

    Size:
    1010 amino acids
    Molecular mass:
    114481 Da
    Cofactor:
    Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937;
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=BAA86604.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Alternative splice isoforms for OGDHL Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for OGDHL Gene

Selected DME Specific Peptides for OGDHL Gene

Q9ULD0:
  • RLSGQDV
  • GQAKWVR
  • KSLLRHP
  • VVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVN
  • GPEHSSAR
  • GKTKAEQFY
  • GMPHRGRLNVLANV
  • LPTTTFIGG
  • HLAVQSLIRAYQIRGHHVAQLDPLGILDADLDS
  • LREIIRRLE
  • GTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPI
  • QLYDCNW
  • EGSGDVKYHLG
  • RKWSSEKRFGLEGCEV
  • FQRVIPE
  • RRQILLPFRKPLI
  • TPKSLLR
  • LSLVANPSHLE
  • RTVDWALAEYM
  • VLGFELG
  • VANPSHLEAVDPVV
  • DLVCYRR
  • RGTFSHRH
  • DCNWIVVNCS
  • KLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLD
  • FCTGKVYY
  • GRDPAAAPATGN
  • DEPMFTQPLMY
  • SVHKSWD

Post-translational modifications for OGDHL Gene

No Post-translational modifications

Domains & Families for OGDHL Gene

Gene Families for OGDHL Gene

Human Protein Atlas (HPA):
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for OGDHL Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9ULD0

UniProtKB/Swiss-Prot:

OGDHL_HUMAN :
  • Belongs to the alpha-ketoglutarate dehydrogenase family.
Family:
  • Belongs to the alpha-ketoglutarate dehydrogenase family.
genes like me logo Genes that share domains with OGDHL: view

Function for OGDHL Gene

Molecular function for OGDHL Gene

GENATLAS Biochemistry:
alpha-ketoglutarate dehydrogenase,E1k subunit-like sequence

Enzyme Numbers (IUBMB) for OGDHL Gene

Gene Ontology (GO) - Molecular Function for OGDHL Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004591 oxoglutarate dehydrogenase (succinyl-transferring) activity IBA --
GO:0005515 protein binding IPI 21988832
GO:0016491 oxidoreductase activity IEA --
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor IEA --
GO:0030976 thiamine pyrophosphate binding IEA --
genes like me logo Genes that share ontologies with OGDHL: view
genes like me logo Genes that share phenotypes with OGDHL: view

Animal Model Products

miRNA for OGDHL Gene

miRTarBase miRNAs that target OGDHL

Clone Products

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for OGDHL Gene

Localization for OGDHL Gene

Subcellular locations from UniProtKB/Swiss-Prot for OGDHL Gene

Mitochondrion matrix.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OGDHL gene
Compartment Confidence
mitochondrion 5
nucleus 2
cytosol 2

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Nucleoli fibrillar center (2)
  • Nucleus (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for OGDHL Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IBA --
GO:0005759 mitochondrial matrix IEA --
GO:0005829 NOT cytosol IBA --
GO:0045252 oxoglutarate dehydrogenase complex IBA --
genes like me logo Genes that share ontologies with OGDHL: view

Pathways & Interactions for OGDHL Gene

genes like me logo Genes that share pathways with OGDHL: view

Pathways by source for OGDHL Gene

Gene Ontology (GO) - Biological Process for OGDHL Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006096 glycolytic process IEA --
GO:0006099 tricarboxylic acid cycle IBA --
GO:0008152 metabolic process IEA --
GO:0055114 oxidation-reduction process IEA --
genes like me logo Genes that share ontologies with OGDHL: view

No data available for SIGNOR curated interactions for OGDHL Gene

Drugs & Compounds for OGDHL Gene

(6) Drugs for OGDHL Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carbon dioxide Approved, Investigational, Vet_approved Pharma 0
NADH Approved Nutra 0
2-Ketobutyric acid Experimental Pharma 0
Succinyl-CoA Experimental Pharma 0
Coenzyme A Investigational Nutra 0

(7) Additional Compounds for OGDHL Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
3-Carboxy-1-hydroxypropylthiamine diphosphate
  • 2-(3-Carboxy-1-hydroxypropyl)thiamine diphosphate
  • 3-Carboxy-1-hydroxypropyl-ThPP
  • 3-[(4-Amino-2-methylpyrimidin-5-yl)methyl]-2-(3-carboxy-1-hydroxypropyl)-5-(2-diphosphoethyl)-4-methyl-1,3-thiazol-3-ium
Glutaryl-coa
  • Glutaryl-CoA
  • Glutaryl-coenzyme A
103192-48-9
Hydrogen Ion
  • Hydrogen cation
  • Hydron
  • Proton
Oxoadipic acid
  • 2-Keto-adipate
  • 2-Ketoadipate
  • 2-Ketoadipic acid
  • 2-Oxo-hexanedioate
  • 2-Oxo-hexanedioic acid
3184-35-8
Oxoglutaric acid
  • 2-Ketoglutarate
  • 2-Ketoglutaric acid
  • 2-Oxo-1,5-pentanedioate
  • 2-Oxo-1,5-pentanedioic acid
  • 2-Oxoglutarate
328-50-7
genes like me logo Genes that share compounds with OGDHL: view

Transcripts for OGDHL Gene

Unigene Clusters for OGDHL Gene

Oxoglutarate dehydrogenase-like:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for OGDHL Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b · 6c · 6d · 6e · 6f ^ 7 ^ 8a · 8b · 8c ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b ^ 13a ·
SP1: - - - - - - -
SP2:
SP3:
SP4: - - - - - - - - -
SP5: - - - - - - -
SP6: - - - - - - - - - - -
SP7: - - - - -
SP8:
SP9: - - - - - - - -
SP10: - - -
SP11:
SP12:
SP13: - - -
SP14: - - - -
SP15: - - -
SP16: - - -
SP17:

ExUns: 13b ^ 14 ^ 15 ^ 16 ^ 17a · 17b ^ 18 ^ 19 ^ 20a · 20b ^ 21 ^ 22a · 22b ^ 23 ^ 24 ^ 25a · 25b · 25c ^ 26 ^ 27a · 27b · 27c · 27d
SP1: - -
SP2: -
SP3: -
SP4:
SP5:
SP6:
SP7:
SP8: -
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for OGDHL Gene

GeneLoc Exon Structure for
OGDHL
ECgene alternative splicing isoforms for
OGDHL

Expression for OGDHL Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for OGDHL Gene

mRNA differential expression in normal tissues according to GTEx for OGDHL Gene

This gene is overexpressed in Kidney - Cortex (x8.8) and Liver (x6.0).

Protein differential expression in normal tissues from HIPED for OGDHL Gene

This gene is overexpressed in Bone marrow mesenchymal stem cell (24.2), Brain (16.9), and Frontal cortex (10.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for OGDHL Gene



NURSA nuclear receptor signaling pathways regulating expression of OGDHL Gene:

OGDHL

SOURCE GeneReport for Unigene cluster for OGDHL Gene:

Hs.17860

Evidence on tissue expression from TISSUES for OGDHL Gene

  • Nervous system(5)
  • Kidney(4.5)
  • Liver(4.4)
genes like me logo Genes that share expression patterns with OGDHL: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for OGDHL Gene

Orthologs for OGDHL Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OGDHL Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia OGDHL 33 34
  • 96.07 (n)
dog
(Canis familiaris)
Mammalia OGDHL 33 34
  • 90.56 (n)
cow
(Bos Taurus)
Mammalia OGDHL 33 34
  • 90.13 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia OGDHL 34
  • 88 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ogdhl 33
  • 87.92 (n)
mouse
(Mus musculus)
Mammalia Ogdhl 33 16 34
  • 87.62 (n)
oppossum
(Monodelphis domestica)
Mammalia OGDHL 34
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves OGDHL 33 34
  • 74.51 (n)
lizard
(Anolis carolinensis)
Reptilia OGDHL 34
  • 83 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ogdhl 33
  • 72.82 (n)
zebrafish
(Danio rerio)
Actinopterygii OGDHL 34
  • 78 (a)
OneToOne
ogdhl 33
  • 73.1 (n)
fruit fly
(Drosophila melanogaster)
Insecta Nc73EF 34
  • 56 (a)
ManyToMany
CG33791 34
  • 42 (a)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea ogdh-1 34
  • 55 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KGD1 34
  • 44 (a)
OneToMany
barley
(Hordeum vulgare)
Liliopsida Hv.506 33
rice
(Oryza sativa)
Liliopsida Os.13926 33
wheat
(Triticum aestivum)
Liliopsida Ta.2604 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.7934 34
  • 63 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4680 33
Species where no ortholog for OGDHL was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for OGDHL Gene

ENSEMBL:
Gene Tree for OGDHL (if available)
TreeFam:
Gene Tree for OGDHL (if available)

Paralogs for OGDHL Gene

Paralogs for OGDHL Gene

(2) SIMAP similar genes for OGDHL Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with OGDHL: view

Variants for OGDHL Gene

Sequence variations from dbSNP and Humsavar for OGDHL Gene

SNP ID Clin Chr 10 pos Variation AA Info Type
rs143105288 likely-benign, Inborn genetic diseases 49,739,779(-) A/G/T coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs150231967 likely-benign, Inborn genetic diseases 49,750,849(-) T/A 5_prime_UTR_variant, coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs773888308 likely-pathogenic, Abnormality of brain morphology 49,738,249(-) G/A/C coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs1000193385 -- 49,746,156(-) C/T intron_variant
rs1000211187 -- 49,746,343(-) A/T intron_variant

Structural Variations from Database of Genomic Variants (DGV) for OGDHL Gene

Variant ID Type Subtype PubMed ID
esv2588189 CNV insertion 19546169
esv3401087 CNV duplication 20981092
nsv1042677 CNV loss 25217958
nsv1048905 CNV gain 25217958

Variation tolerance for OGDHL Gene

Residual Variation Intolerance Score: 19.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.66; 72.84% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for OGDHL Gene

Human Gene Mutation Database (HGMD)
OGDHL
SNPedia medical, phenotypic, and genealogical associations of SNPs for
OGDHL

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OGDHL Gene

Disorders for OGDHL Gene

Additional Disease Information for OGDHL

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for OGDHL Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for OGDHL Gene

Publications for OGDHL Gene

  1. Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10574462) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 2 3 4 58
  2. Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals. (PMID: 19851296) Oguri M … Yamada Y (American journal of hypertension 2010) 3 44 58
  3. Association of genetic variants with hemorrhagic stroke in Japanese individuals. (PMID: 20198315) Yoshida T … Yamada Y (International journal of molecular medicine 2010) 3 44 58
  4. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 44 58
  5. Association of gene polymorphisms with chronic kidney disease in Japanese individuals. (PMID: 19724895) Yoshida T … Yamada Y (International journal of molecular medicine 2009) 3 44 58

Products for OGDHL Gene

Sources for OGDHL Gene

Content
Loading form....