Free for academic non-profit institutions. Other users need a Commercial license

Aliases for BMP2K Gene

Aliases for BMP2K Gene

  • BMP2 Inducible Kinase 2 3 5
  • EC 2.7.11.1 4 61
  • BIKE 3 4
  • BMP-2-Inducible Protein Kinase 3
  • HRIHFB2017 3

External Ids for BMP2K Gene

Previous GeneCards Identifiers for BMP2K Gene

  • GC04P080090
  • GC04P080155
  • GC04P080054
  • GC04P079916
  • GC04P079697
  • GC04P075443

Summaries for BMP2K Gene

Entrez Gene Summary for BMP2K Gene

  • This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for BMP2K Gene

BMP2K (BMP2 Inducible Kinase) is a Protein Coding gene. Among its related pathways are Transcriptional misregulation in cancer. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is AAK1.

UniProtKB/Swiss-Prot for BMP2K Gene

  • May be involved in osteoblast differentiation.

Gene Wiki entry for BMP2K Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for BMP2K Gene

Genomics for BMP2K Gene

Regulatory Elements for BMP2K Gene

Enhancers for BMP2K Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH04G078691 2 FANTOM5 Ensembl ENCODE dbSUPER 38.8 -83.2 -83237 4.0 HDGF PKNOX1 CREB3L1 ARNT ZNF766 CBX5 FOS KLF13 JUNB REST BMP2K LINC00989 SERBP1P5 OR7E94P ENSG00000200998 RPS21P3 GC04P078707 HIGD1AP13
GH04G078621 1.9 FANTOM5 Ensembl ENCODE dbSUPER 18.4 -149.7 -149655 10.5 HDGF PKNOX1 FOXA2 ARNT YBX1 ZNF766 FOS JUNB REST TBX21 BMP2K RPS21P3 LINC01094 LINC01088 GC04M078633 ENSG00000200998 ANXA3
GH04G078616 1.4 FANTOM5 ENCODE dbSUPER 24.7 -159.9 -159898 0.8 HDAC1 PKNOX1 ATF1 ZBTB40 CHAMP1 ZNF766 CREM ZNF592 POLR2H MEF2D BMP2K RPS21P3 GC04M078633 ENSG00000200998 ANXA3
GH04G078644 1.8 FANTOM5 Ensembl ENCODE dbSUPER 17.1 -130.5 -130489 2.7 HDGF ATF1 CREB3L1 SIN3A GATA2 ZNF143 FOS JUNB REST ZNF592 BMP2K RPS21P3 LINC01094 ENSG00000200998 GC04M078633
GH04G078704 1.4 Ensembl ENCODE dbSUPER 19 -71.0 -70996 2.3 FOXA2 ZNF493 ZFP64 ZNF121 FOS ZNF202 SP3 REST ZNF623 ZNF518A CNOT6L BMP2K RPS21P3 ENSG00000200998 SERBP1P5 LINC01094 GC04P078707 HIGD1AP13
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around BMP2K on UCSC Golden Path with GeneCards custom track

Promoters for BMP2K Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000169758 458 3601 CREB3L1 WRNIP1 ARID4B SIN3A FEZF1 DMAP1 ZBTB7B YY1 ZNF143 FOS

Genomic Location for BMP2K Gene

Chromosome:
4
Start:
78,776,342 bp from pter
End:
78,916,372 bp from pter
Size:
140,031 bases
Orientation:
Plus strand

Genomic View for BMP2K Gene

Genes around BMP2K on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
BMP2K Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for BMP2K Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for BMP2K Gene

Proteins for BMP2K Gene

  • Protein details for BMP2K Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9NSY1-BMP2K_HUMAN
    Recommended name:
    BMP-2-inducible protein kinase
    Protein Accession:
    Q9NSY1
    Secondary Accessions:
    • O94791
    • Q4W5H2
    • Q8IYF2
    • Q8N2G7
    • Q8NHG9
    • Q9NTG8

    Protein attributes for BMP2K Gene

    Size:
    1161 amino acids
    Molecular mass:
    129172 Da
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for BMP2K Gene

    Alternative splice isoforms for BMP2K Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for BMP2K Gene

Selected DME Specific Peptides for BMP2K Gene

Q9NSY1:
  • DIWALGCLLYKL
  • YVLCDFGSATNKF
  • FTLPFGESQVAICDG
  • VWEVLILM
  • EVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILL
  • DNFSKLT
  • EIKKYTTLSYRAPEM
  • TETSIAPRQRPKA
  • FTIPDNSRYS

Post-translational modifications for BMP2K Gene

Domains & Families for BMP2K Gene

Gene Families for BMP2K Gene

Graphical View of Domain Structure for InterPro Entry

Q9NSY1

UniProtKB/Swiss-Prot:

BMP2K_HUMAN :
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
genes like me logo Genes that share domains with BMP2K: view

Function for BMP2K Gene

Molecular function for BMP2K Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
May be involved in osteoblast differentiation.

Enzyme Numbers (IUBMB) for BMP2K Gene

Gene Ontology (GO) - Molecular Function for BMP2K Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IBA,IEA --
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with BMP2K: view
genes like me logo Genes that share phenotypes with BMP2K: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for BMP2K

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for BMP2K Gene

Localization for BMP2K Gene

Subcellular locations from UniProtKB/Swiss-Prot for BMP2K Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for BMP2K gene
Compartment Confidence
nucleus 5
cytosol 3

Gene Ontology (GO) - Cellular Components for BMP2K Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IBA --
GO:0016607 nuclear speck IDA --
genes like me logo Genes that share ontologies with BMP2K: view

Pathways & Interactions for BMP2K Gene

genes like me logo Genes that share pathways with BMP2K: view

Pathways by source for BMP2K Gene

1 KEGG pathway for BMP2K Gene

Gene Ontology (GO) - Biological Process for BMP2K Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA,IBA --
GO:0016310 phosphorylation IEA --
GO:0030500 regulation of bone mineralization IEA,IBA --
GO:0045747 positive regulation of Notch signaling pathway IBA --
GO:0050790 regulation of catalytic activity IEA --
genes like me logo Genes that share ontologies with BMP2K: view

No data available for SIGNOR curated interactions for BMP2K Gene

Drugs & Compounds for BMP2K Gene

(1) Drugs for BMP2K Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for BMP2K Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with BMP2K: view

Transcripts for BMP2K Gene

Unigene Clusters for BMP2K Gene

BMP2 inducible kinase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for BMP2K

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for BMP2K Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b ^ 13 ^ 14 ^ 15 ^ 16
SP1: - - -
SP2: - -
SP3:
SP4: -

Relevant External Links for BMP2K Gene

GeneLoc Exon Structure for
BMP2K
ECgene alternative splicing isoforms for
BMP2K

Expression for BMP2K Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for BMP2K Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for BMP2K Gene

This gene is overexpressed in Brain (41.3) and Serum (13.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for BMP2K Gene



NURSA nuclear receptor signaling pathways regulating expression of BMP2K Gene:

BMP2K

SOURCE GeneReport for Unigene cluster for BMP2K Gene:

Hs.146551

Evidence on tissue expression from TISSUES for BMP2K Gene

  • Thyroid gland(4.2)
  • Nervous system(4.2)
  • Liver(4.1)
genes like me logo Genes that share expression patterns with BMP2K: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for BMP2K Gene

Orthologs for BMP2K Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for BMP2K Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia BMP2K 34 35
  • 99.31 (n)
dog
(Canis familiaris)
Mammalia BMP2K 34 35
  • 90.76 (n)
cow
(Bos Taurus)
Mammalia BMP2K 34 35
  • 86.01 (n)
mouse
(Mus musculus)
Mammalia Bmp2k 34 16 35
  • 83.6 (n)
rat
(Rattus norvegicus)
Mammalia Bmp2k 34
  • 83.22 (n)
oppossum
(Monodelphis domestica)
Mammalia BMP2K 35
  • 77 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia BMP2K 35
  • 71 (a)
OneToOne
chicken
(Gallus gallus)
Aves BMP2K 34 35
  • 80.02 (n)
lizard
(Anolis carolinensis)
Reptilia BMP2K 35
  • 68 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia bmp2k 34
  • 68.64 (n)
Str.14011 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.9335 34
zebrafish
(Danio rerio)
Actinopterygii bmp2k 34 35
  • 68.33 (n)
fruit fly
(Drosophila melanogaster)
Insecta Nak 35
  • 20 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea sel-5 35
  • 17 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ARK1 35
  • 22 (a)
ManyToMany
PRK1 35
  • 19 (a)
ManyToMany
AKL1 35
  • 15 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 36 (a)
OneToMany
Species where no ortholog for BMP2K was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for BMP2K Gene

ENSEMBL:
Gene Tree for BMP2K (if available)
TreeFam:
Gene Tree for BMP2K (if available)

Paralogs for BMP2K Gene

Paralogs for BMP2K Gene

(5) SIMAP similar genes for BMP2K Gene using alignment to 4 proteins:

Pseudogenes.org Pseudogenes for BMP2K Gene

genes like me logo Genes that share paralogs with BMP2K: view

Variants for BMP2K Gene

Sequence variations from dbSNP and Humsavar for BMP2K Gene

SNP ID Clin Chr 04 pos Sequence Context AA Info Type
rs770167074 A lung squamous cell carcinoma sample 78,826,060(+) TCCTC(A/G)TGCGT reference, missense, utr-variant-5-prime
rs138262352 Benign 78,912,028(+) CTAAA(C/G/T)AGTAG intron-variant, reference, missense, stop-gained
rs1000008704 -- 78,784,129(+) TTCTG(A/G)TCTTG intron-variant
rs1000066012 -- 78,831,199(+) AGTTC(A/T)CTGTG intron-variant
rs1000075556 -- 78,790,661(+) AGTAA(C/T)ACCAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for BMP2K Gene

Variant ID Type Subtype PubMed ID
dgv5329n100 CNV loss 25217958
esv26247 CNV loss 19812545
esv2727859 CNV deletion 23290073
esv3307766 CNV mobile element insertion 20981092
esv3438049 CNV insertion 20981092
esv3564123 CNV deletion 23714750
esv3575753 CNV gain 25503493
esv990407 CNV insertion 20482838
nsv1006026 CNV loss 25217958
nsv1073345 CNV deletion 25765185
nsv1145034 CNV deletion 24896259
nsv508291 CNV deletion 20534489
nsv594706 CNV gain+loss 21841781
nsv822627 CNV loss 20364138
nsv829979 CNV gain 17160897

Variation tolerance for BMP2K Gene

Residual Variation Intolerance Score: 60.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.80; 83.41% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for BMP2K Gene

Human Gene Mutation Database (HGMD)
BMP2K
SNPedia medical, phenotypic, and genealogical associations of SNPs for
BMP2K

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for BMP2K Gene

Disorders for BMP2K Gene

Relevant External Links for BMP2K

Genetic Association Database (GAD)
BMP2K
Human Genome Epidemiology (HuGE) Navigator
BMP2K
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
BMP2K

No disorders were found for BMP2K Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for BMP2K Gene

Publications for BMP2K Gene

  1. A novel genetic variant of BMP2K contributes to high myopia. (PMID: 19927351) Liu H.P. … Tsai F.J. (J. Clin. Lab. Anal. 2009) 3 22 46 64
  2. High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men. (PMID: 19453261) Yerges L.M. … Zmuda J.M. (J. Bone Miner. Res. 2009) 3 46 64
  3. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PMID: 17081983) Olsen J.V. … Mann M. (Cell 2006) 3 4 64
  4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64

Products for BMP2K Gene

Sources for BMP2K Gene

Content
Loading form....