Aliases for BMP2K Gene
Aliases for BMP2K Gene
External Ids for BMP2K Gene
- HGNC: 18041
- Entrez Gene: 55589
- Ensembl: ENSG00000138756
- OMIM: 617648
- UniProtKB: Q9NSY1
Previous GeneCards Identifiers for BMP2K Gene
- GC04P080090
- GC04P080155
- GC04P080054
- GC04P079916
- GC04P079697
- GC04P075443
Summaries for BMP2K Gene
-
This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
GeneCards Summary for BMP2K Gene
BMP2K (BMP2 Inducible Kinase) is a Protein Coding gene. Among its related pathways are Transcriptional misregulation in cancer. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is AAK1.
UniProtKB/Swiss-Prot for BMP2K Gene
-
May be involved in osteoblast differentiation.
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for BMP2K Gene
Genomics for BMP2K Gene
GeneHancer (GH) Regulatory Elements for BMP2K Gene
Regulatory Element Products
Genomic Locations for BMP2K Gene
- chr4:78,776,342-78,916,372
- (GRCh38/hg38)
- Size:
- 140,031 bases
- Orientation:
- Plus strand
- chr4:79,697,496-79,837,526
- (GRCh37/hg19)
Genomic View for BMP2K Gene
- Cytogenetic band:
-
- 4q21.21 by Ensembl
- 4q21.21 by Entrez Gene
- 4q21.21 by HGNC


RefSeq DNA sequence for BMP2K Gene
Proteins for BMP2K Gene
-
Protein details for BMP2K Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9NSY1-BMP2K_HUMAN
- Recommended name:
- BMP-2-inducible protein kinase
- Protein Accession:
- Q9NSY1
- O94791
- Q4W5H2
- Q8IYF2
- Q8N2G7
- Q8NHG9
- Q9NTG8
Protein attributes for BMP2K Gene
- Size:
- 1161 amino acids
- Molecular mass:
- 129172 Da
- Quaternary structure:
- No Data Available
Three dimensional structures from OCA and Proteopedia for BMP2K Gene
Protein Expression for BMP2K Gene
Selected DME Specific Peptides for BMP2K Gene
- Q9NSY1:
-
- DIWALGCLLYKL
- YVLCDFGSATNKF
- FTLPFGESQVAICDG
- VWEVLILM
- EVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILL
- DNFSKLT
- EIKKYTTLSYRAPEM
- TETSIAPRQRPKA
- FTIPDNSRYS
Post-translational modifications for BMP2K Gene
- Autophosphorylated.
Other Protein References for BMP2K Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for BMP2K
- Novus Biologicals Antibodies for BMP2K
-
Abcam antibodies for BMP2K
- Invitrogen Antibodies for BMP2K
- GeneTex BMP2K antibody for BMP2K
-
Santa Cruz Biotechnology (SCBT) Antibodies for BMP2K
Protein Products
-
OriGene Purified Proteins for BMP2K
- Search Origene for MassSpec and Protein Over-expression Lysates for BMP2K
- Origene Custom Protein Services for BMP2K
- antibodies-online: Search results for 6 available BMP2K Proteins ranked by validation data
- Compare Top BMP2K Proteins
-
Quality Products:
- Search GeneTex for Proteins for BMP2K
-
Abcam proteins for BMP2K
Assay Products
- antibodies-online: Search results for 3 available BMP2K Elisa Kits ranked by validation data
- Compare Top BMP2K Elisa Kits
-
Quality Products:
Domains & Families for BMP2K Gene
Gene Families for BMP2K Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for BMP2K Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for BMP2K Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9NSY1UniProtKB/Swiss-Prot:
BMP2K_HUMAN :- Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
- Family:
-
- Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Function for BMP2K Gene
Molecular function for BMP2K Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- May be involved in osteoblast differentiation.
Enzyme Numbers (IUBMB) for BMP2K Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004672 | protein kinase activity | IEA | -- |
GO:0004674 | protein serine/threonine kinase activity | IBA | -- |
GO:0005524 | ATP binding | IEA | -- |
GO:0016301 | kinase activity | IEA | -- |
GO:0016740 | transferase activity | IEA | -- |
Phenotypes for BMP2K Gene
- MGI mutant phenotypes for BMP2K:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for BMP2K:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Decreased hepcidin::fluc mRNA expression
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased human papilloma virus 16 (HPV16) pseudovirus infection
- Increased transferrin (TF) endocytosis
- Negative genetic interaction between KRASG13D/+ and KRAS+/-
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased HIV-LTR-beta-galactosidase protein expression
- Negative genetic interaction between PTTG1-/- and PTTG1+/+
- Decreased shRNA abundance (Z-score < -2)
- Decreased shRNA abundance
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Negative genetic interaction between BLM-/- and BLM+/+
- Decreased viability of wild-type and TP53 knockout cells
- Decreased substrate adherent cell growth
- Decreased viability after gemcitabine stimulation
- Decreased Hepatitis C Virus pseudoparticles (HCVpp
- Increased senescence-associated beta-galactosidase protein expression after pRB stimulation
- Decreased telomerase activity
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for BMP2K gene
-
ViGene Biosciences ready-to-package AAV shRNAs for BMP2K gene
- Search ViGene Biosciences for BMP2K
CRISPR Products
-
OriGene CRISPR knockouts for BMP2K
- genomics-online: gRNA clones - Search results for available BMP2K gene related products
- Applied Biological Materials CRISPR for BMP2K
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for BMP2K
- GenScript: Design CRISPR guide RNA sequences for BMP2K
miRNA for BMP2K Gene
- miRTarBase miRNAs that target BMP2K
-
- hsa-mir-192-5p (MIRT026511)
- hsa-mir-98-5p (MIRT027518)
- hsa-let-7e-5p (MIRT051629)
- hsa-mir-1228-3p (MIRT054907)
- hsa-mir-190a-3p (MIRT512218)
- hsa-mir-5011-5p (MIRT512219)
- hsa-mir-1277-5p (MIRT512220)
- hsa-mir-6885-3p (MIRT524746)
- hsa-mir-6771-3p (MIRT524747)
- hsa-mir-1909-5p (MIRT538940)
- hsa-mir-4693-3p (MIRT538941)
- hsa-mir-551b-5p (MIRT538942)
- hsa-mir-4311 (MIRT538943)
- hsa-mir-548c-3p (MIRT538944)
- hsa-mir-4477a (MIRT538945)
- hsa-mir-508-5p (MIRT538946)
- hsa-mir-3145-5p (MIRT538947)
- hsa-mir-606 (MIRT538948)
- hsa-mir-5582-3p (MIRT538949)
- hsa-mir-548f-3p (MIRT538950)
- hsa-mir-548e-3p (MIRT538951)
- hsa-mir-548az-3p (MIRT538952)
- hsa-mir-548ar-3p (MIRT538953)
- hsa-mir-548a-3p (MIRT538954)
- hsa-mir-4672 (MIRT538955)
- hsa-mir-466 (MIRT538956)
- hsa-mir-3941 (MIRT538957)
- hsa-mir-610 (MIRT538958)
- hsa-mir-4643 (MIRT538959)
- hsa-mir-4789-3p (MIRT538960)
- hsa-mir-4465 (MIRT568257)
- hsa-mir-26b-5p (MIRT568258)
- hsa-mir-26a-5p (MIRT568259)
- hsa-mir-1297 (MIRT568260)
- hsa-mir-5697 (MIRT568261)
- hsa-mir-101-5p (MIRT568262)
- hsa-mir-8062 (MIRT568263)
- hsa-mir-8079 (MIRT568264)
- hsa-mir-1245a (MIRT568265)
miRNA Products
- Search ViGene Biosciences for BMP2K
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for BMP2K
- Browse OriGene Inhibitory RNA Products For BMP2K
- genomics-online: shRNA clones - Search results for available BMP2K gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for BMP2K gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for BMP2K
- genomics-online: cdna clones - Search results for available BMP2K gene related products
- orf clones - Search results for available BMP2K gene related products
- Applied Biological Materials Clones for BMP2K
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for BMP2K
-
ViGene Biosciences adenoviral particle packaged cDNA for BMP2K gene
-
ViGene Biosciences lentiviral particle packaged cDNA for BMP2K gene
-
ViGene Biosciences ready-to-package AAV shRNAs for BMP2K gene
No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for BMP2K Gene
Localization for BMP2K Gene
Subcellular locations from UniProtKB/Swiss-Prot for BMP2K Gene
- Nucleus.
- Nuclear speckles (3)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005634 | nucleus | IEA | -- |
GO:0005737 | cytoplasm | IBA | -- |
GO:0016607 | nuclear speck | IDA | -- |
Pathways & Interactions for BMP2K Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Transcriptional misregulation in cancer |
Pathways by source for BMP2K Gene
1 KEGG pathway for BMP2K Gene
Interacting Proteins for BMP2K Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | IBA,IEA | -- |
GO:0016310 | phosphorylation | IEA | -- |
GO:0030500 | regulation of bone mineralization | IBA,IEA | -- |
GO:0045747 | positive regulation of Notch signaling pathway | IBA | -- |
GO:0050790 | regulation of catalytic activity | IEA | -- |
No data available for SIGNOR curated interactions for BMP2K Gene
Drugs & Compounds for BMP2K Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
ATP | Investigational | Nutra | Agonist | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for BMP2K Gene
mRNA/cDNA for BMP2K Gene
- (6) REFSEQ mRNAs :
- (9) Additional mRNA sequences :
- (130) Selected AceView cDNA sequences:
- (8) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for BMP2K
- genomics-online: gRNA clones - Search results for available BMP2K gene related products
- Applied Biological Materials CRISPR for BMP2K
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for BMP2K
- GenScript: Design CRISPR guide RNA sequences for BMP2K
miRNA Products
- Search ViGene Biosciences for BMP2K
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for BMP2K
- Browse OriGene Inhibitory RNA Products For BMP2K
- genomics-online: shRNA clones - Search results for available BMP2K gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for BMP2K gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for BMP2K
- genomics-online: cdna clones - Search results for available BMP2K gene related products
- orf clones - Search results for available BMP2K gene related products
- Applied Biological Materials Clones for BMP2K
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | ^ | 11a | · | 11b | ^ | 12a | · | 12b | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | ||||||||||||||||||||||||||||||||||||||
SP2: | - | - | |||||||||||||||||||||||||||||||||||||||
SP3: | |||||||||||||||||||||||||||||||||||||||||
SP4: | - |
Expression for BMP2K Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- Proerythroblasts Hematopoietic Bone Marrow
- Eye (Sensory Organs)
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for BMP2K Gene
NURSA nuclear receptor signaling pathways regulating expression of BMP2K Gene:
BMP2KSOURCE GeneReport for Unigene cluster for BMP2K Gene:
Hs.146551Evidence on tissue expression from TISSUES for BMP2K Gene
- Thyroid gland(4.2)
- Nervous system(4.2)
- Liver(4.1)
Primer Products
-
OriGene qPCR primer pairs for BMP2K
-
OriGene qPCR primer pairs and template standards for BMP2K
- genomics-online: primer clones - Search results for available BMP2K gene related products
No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for BMP2K Gene
Orthologs for BMP2K Gene
This gene was present in the common ancestor of animals and fungi.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | BMP2K 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | BMP2K 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | BMP2K 33 34 |
|
||
mouse (Mus musculus) |
Mammalia | Bmp2k 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Bmp2k 33 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | BMP2K 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | BMP2K 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | BMP2K 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | BMP2K 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | bmp2k 33 |
|
||
Str.14011 33 |
|
||||
African clawed frog (Xenopus laevis) |
Amphibia | Xl.9335 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | bmp2k 33 34 |
|
||
fruit fly (Drosophila melanogaster) |
Insecta | Nak 34 |
|
OneToMany | |
worm (Caenorhabditis elegans) |
Secernentea | sel-5 34 |
|
ManyToMany | |
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | ARK1 34 |
|
ManyToMany | |
PRK1 34 |
|
ManyToMany | |||
AKL1 34 |
|
ManyToMany | |||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany |
- Species where no ortholog for BMP2K was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for BMP2K Gene
(5) SIMAP similar genes for BMP2K Gene using alignment to 4 proteins:
Pseudogenes.org Pseudogenes for BMP2K Gene
Variants for BMP2K Gene
SNP ID | Clin | Chr 04 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs770167074 | A lung squamous cell carcinoma sample | 78,826,060(+) | G/A/C | 5_prime_UTR_variant, coding_sequence_variant, genic_upstream_transcript_variant, missense_variant | |
rs138262352 | benign, not specified | 78,912,028(+) | C/G/T | coding_sequence_variant, genic_downstream_transcript_variant, missense_variant, stop_gained | |
rs1000008704 | -- | 78,784,129(+) | A/G | genic_upstream_transcript_variant, intron_variant | |
rs1000066012 | -- | 78,831,199(+) | A/T | genic_upstream_transcript_variant, intron_variant | |
rs1000075556 | -- | 78,790,661(+) | C/T | genic_upstream_transcript_variant, intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv5329n100 | CNV | loss | 25217958 |
esv26247 | CNV | loss | 19812545 |
esv2727859 | CNV | deletion | 23290073 |
esv3307766 | CNV | mobile element insertion | 20981092 |
esv3438049 | CNV | insertion | 20981092 |
esv3564123 | CNV | deletion | 23714750 |
esv3575753 | CNV | gain | 25503493 |
esv990407 | CNV | insertion | 20482838 |
nsv1006026 | CNV | loss | 25217958 |
nsv1073345 | CNV | deletion | 25765185 |
nsv1145034 | CNV | deletion | 24896259 |
nsv508291 | CNV | deletion | 20534489 |
nsv594706 | CNV | gain+loss | 21841781 |
nsv822627 | CNV | loss | 20364138 |
nsv829979 | CNV | gain | 17160897 |
Additional Variant Information for BMP2K Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for BMP2K Gene
Disorders for BMP2K Gene
Additional Disease Information for BMP2K
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for BMP2K Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for BMP2K Gene
Publications for BMP2K Gene
- A novel genetic variant of BMP2K contributes to high myopia. (PMID: 19927351) Liu HP … Tsai FJ (Journal of clinical laboratory analysis 2009) 3 22 44 58
- High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men. (PMID: 19453261) Yerges LM … MrOS Research Group (Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2009) 3 44 58
- Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PMID: 17081983) Olsen JV … Mann M (Cell 2006) 3 4 58
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
Products for BMP2K Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for BMP2K
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for BMP2K
- Search Origene for MassSpec and Protein Over-expression Lysates for BMP2K
- Origene Custom Protein Services for BMP2K
- Origene shrna, sirna, and RNAi products in human, mouse, rat for BMP2K
- Browse OriGene Inhibitory RNA Products For BMP2K
- OriGene qPCR primer pairs and template standards for BMP2K
- OriGene qPCR primer pairs for BMP2K
- OriGene CRISPR knockouts for BMP2K
- OriGene ORF clones in human for BMP2K
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For BMP2K
- GenScript: Next-day shipping of latest version cDNA ORF clones for BMP2K in any vector
- GenScript Custom Purified and Recombinant Proteins Services for BMP2K
- GenScript Custom Assay Services for BMP2K
- GenScript Custom overexpressing Cell Line Services for BMP2K
- GenScript: Design CRISPR guide RNA sequences for BMP2K
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for BMP2K
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for BMP2K
- Novus Biologicals proteins and lysates for BMP2K
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for BMP2K
- Abcam proteins for BMP2K
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for BMP2K
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for BMP2K
- antibodies-online: Search results for 52 available BMP2K Antibodies ranked by validation data
- Compare Top BMP2K Antibodies
- Quality Products:
- antibodies-online: Search results for 3 available BMP2K Elisa Kits ranked by validation data
- Compare Top BMP2K Elisa Kits
- Quality Products:
- antibodies-online: Search results for 6 available BMP2K Proteins ranked by validation data
- Compare Top BMP2K Proteins
- Quality Products:
- GeneTex BMP2K antibody for BMP2K
- Search GeneTex for Proteins for BMP2K
- ViGene Biosciences adenoviral particle packaged cDNA for BMP2K gene
- ViGene Biosciences lentiviral particle packaged cDNA for BMP2K gene
- ViGene Biosciences ready-to-package AAV shRNAs for BMP2K gene
- Search ViGene Biosciences for BMP2K
- Santa Cruz Biotechnology (SCBT) Antibodies for BMP2K
- Search Santa Cruz Biotechnology (SCBT) for BMP2K siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for BMP2K
- Horizon Cell Lines for BMP2K
- genomics-online: cdna clones - Search results for available BMP2K gene related products
- orf clones - Search results for available BMP2K gene related products
- genomics-online: gRNA clones - Search results for available BMP2K gene related products
- genomics-online: primer clones - Search results for available BMP2K gene related products
- genomics-online: shRNA clones - Search results for available BMP2K gene related products
Sources for BMP2K Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew