Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PREP Gene

Aliases for PREP Gene

  • Prolyl Endopeptidase 2 3 5
  • Post-Proline Cleaving Enzyme 3 4
  • Prolyl Oligopeptidase 2 3
  • EC 3.4.21.26 4 61
  • PEP 3 4
  • PE 3 4
  • DJ355L5.1 (Prolyl Endopeptidase) 3

External Ids for PREP Gene

Previous GeneCards Identifiers for PREP Gene

  • GC06M105561
  • GC06M105748
  • GC06M105771
  • GC06M105832
  • GC06M105725
  • GC06M103168

Summaries for PREP Gene

Entrez Gene Summary for PREP Gene

  • The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. [provided by RefSeq, Jul 2008]

GeneCards Summary for PREP Gene

PREP (Prolyl Endopeptidase) is a Protein Coding gene. Diseases associated with PREP include Celiac Disease and Post-Traumatic Stress Disorder. Among its related pathways are Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics. GO annotations related to this gene include serine-type endopeptidase activity and serine-type exopeptidase activity. An important paralog of this gene is PREPL.

UniProtKB/Swiss-Prot for PREP Gene

  • Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.

Gene Wiki entry for PREP Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PREP Gene

Genomics for PREP Gene

Regulatory Elements for PREP Gene

Enhancers for PREP Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH06G105452 1.8 FANTOM5 Ensembl ENCODE dbSUPER 16.1 -53.4 -53354 8.1 HDAC1 TBP PKNOX1 TBL1XR1 WRNIP1 BMI1 RAD21 YY1 TCF12 EGR1 PREP PRDM1 LOC105377921 GC06P105464
GH06G105358 1.4 Ensembl ENCODE dbSUPER 17.6 +43.3 43311 2.4 RAD21 YY1 TCF12 SCRT2 FOS CEBPB ZNF592 NR2F2 SMARCA4 CEBPA PREP PIR51949
GH06G105363 1 ENCODE dbSUPER 18.3 +38.8 38845 1.9 CTCF PKNOX1 TAL1 BACH1 CDC5L RAD21 FOSL1 TCF12 ZNF316 NCOR1 PREP PIR51949
GH06G105370 1 ENCODE dbSUPER 18.1 +30.4 30358 4.9 FOXA2 SAP130 JUN SIN3A CEBPG TEAD3 E2F1 CTBP1 ZNF316 GATA3 PREP ENSG00000231628 PIR51949
GH06G105427 1.1 Ensembl ENCODE 15.8 -25.4 -25390 1.9 TBP FOXA2 RARA RCOR1 RELB MIXL1 THAP11 CEBPB SSRP1 CEBPA PREP GC06P105412 LOC105377921
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PREP on UCSC Golden Path with GeneCards custom track

Promoters for PREP Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000200435 324 2001 PKNOX1 CREB3L1 ARID4B SIN3A ZNF2 ZBTB7B ZNF143 MXD4 REST ZNF592

Genomic Location for PREP Gene

Chromosome:
6
Start:
105,277,565 bp from pter
End:
105,403,124 bp from pter
Size:
125,560 bases
Orientation:
Minus strand

Genomic View for PREP Gene

Genes around PREP on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PREP Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PREP Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PREP Gene

Proteins for PREP Gene

  • Protein details for PREP Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P48147-PPCE_HUMAN
    Recommended name:
    Prolyl endopeptidase
    Protein Accession:
    P48147
    Secondary Accessions:
    • Q8N6D4

    Protein attributes for PREP Gene

    Size:
    710 amino acids
    Molecular mass:
    80700 Da
    Quaternary structure:
    • Monomer.

    Three dimensional structures from OCA and Proteopedia for PREP Gene

neXtProt entry for PREP Gene

Selected DME Specific Peptides for PREP Gene

P48147:
  • KQHFEWL
  • LCAEFPDEPKWMGGAELSDDGRYVLLSI
  • TNEGTVFTFKTNR
  • VFREVTVKGIDA
  • AYGLSASGSDWVTIKFMKVDGAKEL
  • TKIPMFI
  • IYHCDLTKEELEP
  • NQRPDLF
  • RGGGEYG
  • GGSNGGLL
  • GILKWVKLIDNFEGEYDY
  • FKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARV
  • QDYHGHK
  • EIFYQFTSFLSPG
  • TIGHAWTTDYGCSD
  • AAEYLIKE
  • YPQQDGKSDGTETSTNLHQKL
  • YHGHKICDPY
  • TGALLKTFPL
  • YGGFNIS
  • KYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHS
  • VGVMDML

Post-translational modifications for PREP Gene

Other Protein References for PREP Gene

Antibody Products

  • R&D Systems Antibodies for PREP (Prolyl Oligopeptidase/PREP)
  • Santa Cruz Biotechnology (SCBT) Antibodies for PREP

Domains & Families for PREP Gene

Suggested Antigen Peptide Sequences for PREP Gene

Graphical View of Domain Structure for InterPro Entry

P48147

UniProtKB/Swiss-Prot:

PPCE_HUMAN :
  • Belongs to the peptidase S9A family.
Family:
  • Belongs to the peptidase S9A family.
genes like me logo Genes that share domains with PREP: view

No data available for Gene Families for PREP Gene

Function for PREP Gene

Molecular function for PREP Gene

GENATLAS Biochemistry:
prolyl oligopeptidase,alpha/beta hydrolase fold family
UniProtKB/Swiss-Prot CatalyticActivity:
Hydrolysis of Pro- -Xaa >> Ala- -Xaa in oligopeptides.
UniProtKB/Swiss-Prot Function:
Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.

Enzyme Numbers (IUBMB) for PREP Gene

Gene Ontology (GO) - Molecular Function for PREP Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004252 serine-type endopeptidase activity IEA --
GO:0005515 protein binding IPI 23348613
GO:0008233 peptidase activity IEA --
GO:0008236 serine-type peptidase activity TAS 7959018
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PREP: view
genes like me logo Genes that share phenotypes with PREP: view

Animal Models for PREP Gene

MGI Knock Outs for PREP:

Animal Model Products

CRISPR Products

miRNA for PREP Gene

miRTarBase miRNAs that target PREP

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PREP

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PREP Gene

Localization for PREP Gene

Subcellular locations from UniProtKB/Swiss-Prot for PREP Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PREP gene
Compartment Confidence
cytosol 5
nucleus 4
plasma membrane 1
extracellular 1
lysosome 1

Gene Ontology (GO) - Cellular Components for PREP Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm TAS 9695945
GO:0005829 cytosol IDA --
GO:0016020 membrane IDA 19946888
genes like me logo Genes that share ontologies with PREP: view

Pathways & Interactions for PREP Gene

genes like me logo Genes that share pathways with PREP: view

Pathways by source for PREP Gene

1 KEGG pathway for PREP Gene

Gene Ontology (GO) - Biological Process for PREP Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis TAS,IEA --
genes like me logo Genes that share ontologies with PREP: view

No data available for SIGNOR curated interactions for PREP Gene

Drugs & Compounds for PREP Gene

(27) Drugs for PREP Gene - From: DrugBank, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Oxytocin Approved, Vet_approved Pharma Full agonist, Agonist, Enzyme, substrate Involved in uterine contraction and lactation 439
z-pro-prolinal Experimental Pharma Target 0
(6S)-1-chloro-3-[(4-fluorobenzyl)oxy]-6-(pyrrolidin-1-ylcarbonyl)pyrrolo[1,2-a]pyrazin-4(6H)-one Experimental Pharma Target 0
1-{3-oxo-3-[(2S)-2-(pyrrolidin-1-ylcarbonyl)pyrrolidin-1-yl]propyl}-3-phenylquinoxalin-2(1H)-one Experimental Pharma Target 0
1-Hydroxy-1-Thio-Glycerol Experimental Pharma Target 0

(14) Additional Compounds for PREP Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PREP: view

Transcripts for PREP Gene

mRNA/cDNA for PREP Gene

Unigene Clusters for PREP Gene

Prolyl endopeptidase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PREP

Alternative Splicing Database (ASD) splice patterns (SP) for PREP Gene

No ASD Table

Relevant External Links for PREP Gene

GeneLoc Exon Structure for
PREP
ECgene alternative splicing isoforms for
PREP

Expression for PREP Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PREP Gene

mRNA differential expression in normal tissues according to GTEx for PREP Gene

This gene is overexpressed in Muscle - Skeletal (x4.6).

Protein differential expression in normal tissues from HIPED for PREP Gene

This gene is overexpressed in Peripheral blood mononuclear cells (6.6) and Lymph node (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PREP Gene



Protein tissue co-expression partners for PREP Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PREP Gene:

PREP

SOURCE GeneReport for Unigene cluster for PREP Gene:

Hs.436564

Evidence on tissue expression from TISSUES for PREP Gene

  • Blood(4.5)
  • Skin(4.3)
  • Nervous system(4)
  • Heart(2.6)
  • Intestine(2.3)
  • Kidney(2.3)
  • Liver(2.1)
genes like me logo Genes that share expression patterns with PREP: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PREP Gene

Orthologs for PREP Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PREP Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PREP 34 35
  • 99.3 (n)
oppossum
(Monodelphis domestica)
Mammalia PREP 35
  • 93 (a)
OneToOne
dog
(Canis familiaris)
Mammalia PREP 34 35
  • 90.59 (n)
cow
(Bos Taurus)
Mammalia PREP 34 35
  • 90.46 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PREP 35
  • 89 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Prep 34 16 35
  • 88.29 (n)
rat
(Rattus norvegicus)
Mammalia Prep 34
  • 87.12 (n)
chicken
(Gallus gallus)
Aves PREP 34 35
  • 81.1 (n)
lizard
(Anolis carolinensis)
Reptilia PREP 35
  • 87 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia prep 34
  • 76.74 (n)
MGC76255 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.14450 34
zebrafish
(Danio rerio)
Actinopterygii prep 34 35
  • 70.2 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG5355 36 34 35
  • 57.18 (n)
CG2528 36 35
  • 51 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP009172 34
  • 56.59 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G76140 34
  • 60.17 (n)
rice
(Oryza sativa)
Liliopsida Os01g0108200 34
  • 57.66 (n)
Os.15541 34
wheat
(Triticum aestivum)
Liliopsida Ta.21279 34
corn
(Zea mays)
Liliopsida Zm.9529 34
sea squirt
(Ciona savignyi)
Ascidiacea CSA.10320 35
  • 64 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.1572 34
Species where no ortholog for PREP was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • worm (Caenorhabditis elegans)

Evolution for PREP Gene

ENSEMBL:
Gene Tree for PREP (if available)
TreeFam:
Gene Tree for PREP (if available)

Paralogs for PREP Gene

Paralogs for PREP Gene

genes like me logo Genes that share paralogs with PREP: view

Variants for PREP Gene

Sequence variations from dbSNP and Humsavar for PREP Gene

SNP ID Clin Chr 06 pos Sequence Context AA Info Type
rs1000012328 -- 105,309,908(+) TGCCA(C/T)TGAAC intron-variant
rs1000034223 -- 105,317,602(+) CTGTA(C/G)GTGGG intron-variant
rs1000041445 -- 105,300,746(+) AAGCA(C/G)TTTAA intron-variant
rs1000055118 -- 105,336,500(+) TTTTG(C/T)TCCCT intron-variant
rs1000085570 -- 105,309,669(+) CAGAA(A/G)GAGAG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PREP Gene

Variant ID Type Subtype PubMed ID
esv28038 CNV loss 19812545
esv7369 OTHER inversion 19470904
nsv1140195 CNV insertion 24896259
nsv604438 CNV loss 21841781

Variation tolerance for PREP Gene

Residual Variation Intolerance Score: 6.55% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 12.44; 94.30% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PREP Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PREP

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PREP Gene

Disorders for PREP Gene

MalaCards: The human disease database

(3) MalaCards diseases for PREP Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
celiac disease
  • celiac sprue
post-traumatic stress disorder
  • traumatic neurosis
hypotonia-cystinuria syndrome
  • cystinuria with mitochondrial disease
- elite association - COSMIC cancer census association via MalaCards
Search PREP in MalaCards View complete list of genes associated with diseases

Relevant External Links for PREP

Genetic Association Database (GAD)
PREP
Human Genome Epidemiology (HuGE) Navigator
PREP
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PREP
genes like me logo Genes that share disorders with PREP: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PREP Gene

Publications for PREP Gene

  1. Cloning and sequence analysis of the gene encoding human lymphocyte prolyl endopeptidase. (PMID: 7959018) Vanhoof G. … Scharpe S. (Gene 1994) 2 3 4 22 64
  2. No association between the PREP gene and lithium responsive bipolar disorder. (PMID: 17324276) Mamdani F. … Turecki G. (BMC Psychiatry 2007) 3 22 46 64
  3. The purification, characterization and analysis of primary and secondary-structure of prolyl oligopeptidase from human lymphocytes. Evidence that the enzyme belongs to the alpha/beta hydrolase fold family. (PMID: 7588785) Goossens F. … Scharpe S. (Eur. J. Biochem. 1995) 3 4 22 64
  4. Molecular cloning and characterization of prolyl endopeptidase from human T cells. (PMID: 8089089) Shirasawa Y. … Hirashima A. (J. Biochem. 1994) 3 4 22 64
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64

Products for PREP Gene

Sources for PREP Gene

Content
Loading form....