Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TRPM7 Gene

Aliases for TRPM7 Gene

  • Transient Receptor Potential Cation Channel Subfamily M Member 7 2 3 5
  • Long Transient Receptor Potential Channel 7 3 4
  • Channel-Kinase 1 3 4
  • EC 2.7.11.1 4 56
  • LTrpC-7 3 4
  • LTRPC7 3 4
  • CHAK1 3 4
  • Transient Receptor Potential Cation Channel, Subfamily M, Member 7 2
  • Transient Receptor Potential-Phospholipase C-Interacting Kinase 3
  • LTRPC Ion Channel Family Member 7 3
  • TRP-PLIK 3
  • ALSPDC 3
  • CHAK 3

External Ids for TRPM7 Gene

Previous GeneCards Identifiers for TRPM7 Gene

  • GC15M046409
  • GC15M043898
  • GC15M048431
  • GC15M048568
  • GC15M048639
  • GC15M050852
  • GC15M027680

Summaries for TRPM7 Gene

Entrez Gene Summary for TRPM7 Gene

  • This gene belongs to the melastatin subfamily of transient receptor potential family of ion channels. The protein encoded by this gene is both an ion channel and a serine/threonine protein kinase. The kinase activity is essential for the ion channel function, which serves to increase intracellular calcium levels and to help regulate magnesium ion homeostasis. The encoded protein is involved in cytoskeletal organization, cell adhesion, cell migration and organogenesis. Defects in this gene are a cause of amyotrophic lateral sclerosis-parkinsonism/dementia complex of Guam. The gene may also be associated with defects of cardiac function. [provided by RefSeq, Aug 2017]

GeneCards Summary for TRPM7 Gene

TRPM7 (Transient Receptor Potential Cation Channel Subfamily M Member 7) is a Protein Coding gene. Diseases associated with TRPM7 include Amyotrophic Lateral Sclerosis-Parkinsonism/Dementia Complex 1 and Ophthalmomyiasis. Among its related pathways are Necroptosis and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and actin binding. An important paralog of this gene is TRPM6.

UniProtKB/Swiss-Prot for TRPM7 Gene

  • Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. Involved in TNF-induced necroptosis downstream of MLKL by mediating calcium influx. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1).

Gene Wiki entry for TRPM7 Gene

Additional gene information for TRPM7 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TRPM7 Gene

Genomics for TRPM7 Gene

GeneHancer (GH) Regulatory Elements for TRPM7 Gene

Promoters and enhancers for TRPM7 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH15I050685 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 581.3 +0.1 139 2.6 HDGF FOXA2 PKNOX1 SMAD1 MLX ARNT ARID4B SIN3A DMAP1 ZNF2 TRPM7 GABPB1-IT1 USP8 ENSG00000259618 ENSG00000259298 ENSG00000259715 SPPL2A DCAF13P3 RPS20P34 GABPB1-AS1
GH15I050349 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 14 +333.5 333546 8.3 MLX FEZF1 DMAP1 IRF4 YY1 SLC30A9 E2F8 ZNF143 SP3 NFYC GABPB1-AS1 GABPB1 GC15P050351 ENSG00000259715 USP8 GABPB1-IT1 ENSG00000259298 ENSG00000259618 TRPM7 RPS20P34
GH15I050423 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 15 +262.3 262271 2.5 HDGF PKNOX1 SMAD1 ARID4B SIN3A DMAP1 ZBTB7B YY1 SLC30A9 POLR2B USP8 ENSG00000259298 GABPB1-IT1 ENSG00000259618 DTWD1 TRPM7 ENSG00000259715 DCAF13P3 GABPB1-AS1 AP4E1
GH15I050181 Promoter/Enhancer 2.2 EPDnew FANTOM5 Ensembl ENCODE 13.9 +503.2 503189 4 PKNOX1 ATF1 ARID4B SIN3A DMAP1 ZBTB7B ZNF48 YY1 GLIS2 ELK1 SLC27A2 ATP8B4 GABPB1-IT1 ENSG00000259715 ENSG00000259298 GABPB1-AS1 USP8 ENSG00000259618 TRPM7 RPS20P34
GH15I050107 Promoter/Enhancer 2 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 15 +575.6 575584 8.5 PKNOX1 BATF IRF4 ZNF207 ATF7 ETV6 BCLAF1 IKZF2 RUNX3 CBFB ATP8B4 GABPB1-IT1 TRPM7 ENSG00000259715 USP8 RPS20P34 ENSG00000259298 DTWD1 ENSG00000259618 AP4E1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around TRPM7 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the TRPM7 gene promoter:

Genomic Locations for TRPM7 Gene

Genomic Locations for TRPM7 Gene
chr15:50,552,473-50,686,815
(GRCh38/hg38)
Size:
134,343 bases
Orientation:
Minus strand
chr15:50,844,670-50,979,012
(GRCh37/hg19)

Genomic View for TRPM7 Gene

Genes around TRPM7 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TRPM7 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TRPM7 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TRPM7 Gene

Proteins for TRPM7 Gene

  • Protein details for TRPM7 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96QT4-TRPM7_HUMAN
    Recommended name:
    Transient receptor potential cation channel subfamily M member 7
    Protein Accession:
    Q96QT4
    Secondary Accessions:
    • Q6ZMF5
    • Q86VJ4
    • Q8NBW2
    • Q9BXB2
    • Q9NXQ2

    Protein attributes for TRPM7 Gene

    Size:
    1865 amino acids
    Molecular mass:
    212697 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Homodimer. Interacts with PLCB1 (By similarity). Forms heterodimers with TRPM6.
    SequenceCaution:
    • Sequence=BAC11462.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAD18773.1; Type=Erroneous initiation; Evidence={ECO:0000305};

neXtProt entry for TRPM7 Gene

Selected DME Specific Peptides for TRPM7 Gene

Q96QT4:
  • NWSNSTCLKLAVS
  • EGGPNVIL
  • AGRLIYC
  • LEQAMLDALVMDRV
  • MELPKLVISVHGG
  • FLTIPRLEELYNTKQGPTN
  • PRFLEVFL
  • KKLHDFEEQCVE
  • TVLHLCLREIQQQRAAQKL
  • VDDTSEELK
  • WSVEKHT
  • TVYRLEESSP
  • MVFGPANLGEDAI
  • LTPFLQAVYLFVQYIIMVNLLIA
  • PVVVCEGTGRAADLLA
  • SMSSWSQ
  • ERNNLMRLSQ
  • KHVGDALK
  • PWGVIEN
  • MLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIK
  • MTGEFRKYNNNNGDEI
  • LPDLKRNDY
  • ITLIDIGLV
  • IPSSKDPHRC
  • GHLQDLSALTVDTLK

Post-translational modifications for TRPM7 Gene

Domains & Families for TRPM7 Gene

Gene Families for TRPM7 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins
  • Predicted membrane proteins
  • Transporters
  • Voltage-gated ion channels

Suggested Antigen Peptide Sequences for TRPM7 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q96QT4

UniProtKB/Swiss-Prot:

TRPM7_HUMAN :
  • In the C-terminal section; belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
Family:
  • In the C-terminal section; belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
  • In the N-terminal section; belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM7 sub-subfamily.
genes like me logo Genes that share domains with TRPM7: view

Function for TRPM7 Gene

Molecular function for TRPM7 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. Involved in TNF-induced necroptosis downstream of MLKL by mediating calcium influx. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1).

Enzyme Numbers (IUBMB) for TRPM7 Gene

Phenotypes From GWAS Catalog for TRPM7 Gene

Gene Ontology (GO) - Molecular Function for TRPM7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003779 actin binding IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005216 ion channel activity IEA --
GO:0005262 calcium channel activity TAS --
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with TRPM7: view
genes like me logo Genes that share phenotypes with TRPM7: view

Animal Models for TRPM7 Gene

MGI Knock Outs for TRPM7:

miRNA for TRPM7 Gene

miRTarBase miRNAs that target TRPM7

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for TRPM7 Gene

Localization for TRPM7 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TRPM7 Gene

Membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TRPM7 gene
Compartment Confidence
plasma membrane 5
extracellular 2
cytoskeleton 2
nucleus 2
cytosol 2
mitochondrion 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for TRPM7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IEA --
GO:0005623 cell IEA --
GO:0005886 plasma membrane IEA,TAS --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with TRPM7: view

Pathways & Interactions for TRPM7 Gene

genes like me logo Genes that share pathways with TRPM7: view

Pathways by source for TRPM7 Gene

SIGNOR curated interactions for TRPM7 Gene

Activates:

Gene Ontology (GO) - Biological Process for TRPM7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006810 transport IEA --
GO:0006811 ion transport IEA --
GO:0006812 cation transport IEA --
GO:0006816 calcium ion transport IEA --
genes like me logo Genes that share ontologies with TRPM7: view

Drugs & Compounds for TRPM7 Gene

(15) Drugs for TRPM7 Gene - From: DrugBank, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Magnesium Approved Nutra 0
Magnesium carbonate Approved, Investigational Pharma Transporter, substrate 0
Nafamostat Approved, Investigational Pharma Channel blocker 4
spermine Approved Nutra Full agonist, Agonist 0
calcium Approved Nutra 0

(3) Additional Compounds for TRPM7 Gene - From: IUPHAR and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
carvacrol
Channel blocker
H<sup>+</sup> (extracellular)
Activator
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with TRPM7: view

Transcripts for TRPM7 Gene

Unigene Clusters for TRPM7 Gene

Transient receptor potential cation channel, subfamily M, member 7:
Representative Sequences:

Alternative Splicing Database (ASD) splice patterns (SP) for TRPM7 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18a · 18b ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^
SP1:
SP2:
SP3:
SP4: -
SP5:
SP6:

ExUns: 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b ^ 32 ^ 33 ^ 34 ^ 35 ^ 36a · 36b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for TRPM7 Gene

GeneLoc Exon Structure for
TRPM7
ECgene alternative splicing isoforms for
TRPM7

Expression for TRPM7 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for TRPM7 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for TRPM7 Gene

This gene is overexpressed in Serum (65.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TRPM7 Gene



Protein tissue co-expression partners for TRPM7 Gene

NURSA nuclear receptor signaling pathways regulating expression of TRPM7 Gene:

TRPM7

SOURCE GeneReport for Unigene cluster for TRPM7 Gene:

Hs.512894

Evidence on tissue expression from TISSUES for TRPM7 Gene

  • Intestine(4.5)
  • Liver(4.4)
  • Nervous system(2.9)
  • Kidney(2.8)
  • Heart(2.5)
  • Muscle(2.4)

Phenotype-based relationships between genes and organs from Gene ORGANizer for TRPM7 Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • nervous
  • skeletal muscle
Organs:
Head and neck:
  • brain
  • cerebellum
  • cranial nerve
  • face
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • nose
  • skull
  • tongue
Limb:
  • lower limb
  • upper limb
General:
  • peripheral nerve
  • peripheral nervous system
  • spinal cord
genes like me logo Genes that share expression patterns with TRPM7: view

No data available for mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for TRPM7 Gene

Orthologs for TRPM7 Gene

This gene was present in the common ancestor of animals.

Orthologs for TRPM7 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia TRPM7 33 34
  • 99.7 (n)
cow
(Bos Taurus)
Mammalia TRPM7 33 34
  • 94.62 (n)
dog
(Canis familiaris)
Mammalia TRPM7 33 34
  • 94.51 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 34
  • 91 (a)
OneToMany
-- 34
  • 89 (a)
OneToMany
-- 34
  • 84 (a)
OneToMany
mouse
(Mus musculus)
Mammalia Trpm7 33 16 34
  • 90.83 (n)
rat
(Rattus norvegicus)
Mammalia Trpm7 33
  • 90.6 (n)
oppossum
(Monodelphis domestica)
Mammalia TRPM7 34
  • 89 (a)
OneToOne
chicken
(Gallus gallus)
Aves gga-mir-6596 34
  • 86 (a)
OneToOne
TRPM7 33
  • 82.3 (n)
lizard
(Anolis carolinensis)
Reptilia TRPM7 34
  • 85 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia trpm7 33
  • 75.15 (n)
zebrafish
(Danio rerio)
Actinopterygii trpm7 33 34
  • 66.12 (n)
-- 33
fruit fly
(Drosophila melanogaster)
Insecta CG30078 35
  • 43 (a)
CG30079 35
  • 43 (a)
Species where no ortholog for TRPM7 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for TRPM7 Gene

ENSEMBL:
Gene Tree for TRPM7 (if available)
TreeFam:
Gene Tree for TRPM7 (if available)

Paralogs for TRPM7 Gene

Paralogs for TRPM7 Gene

(4) SIMAP similar genes for TRPM7 Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with TRPM7: view

Variants for TRPM7 Gene

Sequence variations from dbSNP and Humsavar for TRPM7 Gene

SNP ID Clin Chr 15 pos Variation AA Info Type
rs1040254222 breast infiltrating ductal carcinoma sample 50,611,215(-) T/A/C coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs8042919 risk-factor, Amyotrophic lateral sclerosis-parkinsonism/dementia complex 1, susceptibility to 50,586,433(-) G/A/T coding_sequence_variant, genic_downstream_transcript_variant, missense_variant, non_coding_transcript_variant
VAR_042396 An ovarian serous carcinoma sample p.Ser406Cys
VAR_042400 A gastric adenocarcinoma sample p.Met830Val
rs1085307123 uncertain-significance, not provided 50,611,212(-) A/C coding_sequence_variant, missense_variant, non_coding_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for TRPM7 Gene

Variant ID Type Subtype PubMed ID
dgv2594n100 CNV gain 25217958
dgv317n27 CNV gain 19166990
dgv4525n54 CNV gain 21841781
dgv4526n54 CNV gain 21841781
esv1392000 CNV insertion 17803354
esv2664477 CNV deletion 23128226
esv2674857 CNV deletion 23128226
esv2749686 CNV deletion 23290073
esv2749687 CNV deletion 23290073
esv3444919 CNV insertion 20981092
esv3552436 CNV deletion 23714750
esv3552437 CNV deletion 23714750
esv3636446 CNV gain 21293372
esv3636447 CNV loss 21293372
esv3636448 CNV loss 21293372
nsv1047443 CNV gain 25217958
nsv1048114 CNV gain 25217958
nsv1050385 CNV gain 25217958
nsv1051400 CNV gain 25217958
nsv1055119 CNV gain 25217958
nsv1127432 CNV deletion 24896259
nsv1147970 CNV deletion 26484159
nsv1532 CNV insertion 18451855
nsv471242 CNV gain 18288195
nsv524596 CNV loss 19592680
nsv524613 CNV loss 19592680
nsv569398 CNV loss 21841781
nsv569401 CNV loss 21841781

Variation tolerance for TRPM7 Gene

Residual Variation Intolerance Score: 1.14% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.62; 72.56% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for TRPM7 Gene

Human Gene Mutation Database (HGMD)
TRPM7
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TRPM7

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TRPM7 Gene

Disorders for TRPM7 Gene

MalaCards: The human disease database

(5) MalaCards diseases for TRPM7 Gene - From: HGMD, OMIM, GTR, Orphanet, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
amyotrophic lateral sclerosis-parkinsonism/dementia complex 1
  • amyotrophic lateral sclerosis-parkinsonism/dementia complex of guam
ophthalmomyiasis
  • ocular myiasis
dementia
  • presenile dementia
lateral sclerosis
  • motor neuron disease
amyotrophic lateral sclerosis 1
  • als1
- elite association - COSMIC cancer census association via MalaCards
Search TRPM7 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

TRPM7_HUMAN
  • Amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (ALS-PDC1) [MIM:105500]: A neurodegenerative disorder characterized by chronic, progressive and uniformly fatal amyotrophic lateral sclerosis and parkinsonism-dementia. Both diseases are known to occur in the same kindred, the same sibship and even the same individual. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.

Additional Disease Information for TRPM7

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with TRPM7: view

No data available for Genatlas for TRPM7 Gene

Publications for TRPM7 Gene

  1. LTRPC7 is a Mg.ATP-regulated divalent cation channel required for cell viability. (PMID: 11385574) Nadler MJ … Fleig A (Nature 2001) 2 3 4 22 58
  2. TRPM7 is not associated with amyotrophic lateral sclerosis-parkinsonism dementia complex in the Kii peninsula of Japan. (PMID: 19405049) Hara K … Tsuji S (American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2010) 3 22 44 58
  3. A TRPM7 variant shows altered sensitivity to magnesium that may contribute to the pathogenesis of two Guamanian neurodegenerative disorders. (PMID: 16051700) Hermosura MC … Garruto RM (Proceedings of the National Academy of Sciences of the United States of America 2005) 3 4 22 58
  4. Regulation of vertebrate cellular Mg2+ homeostasis by TRPM7. (PMID: 12887921) Schmitz C … Scharenberg AM (Cell 2003) 3 4 22 58
  5. Plasma membrane translocation of trimerized MLKL protein is required for TNF-induced necroptosis. (PMID: 24316671) Cai Z … Liu ZG (Nature cell biology 2014) 3 4 58

Products for TRPM7 Gene

Sources for TRPM7 Gene

Content
Loading form....