Aliases for PLD2 Gene
Aliases for PLD2 Gene
External Ids for PLD2 Gene
- HGNC: 9068
- Entrez Gene: 5338
- Ensembl: ENSG00000129219
- OMIM: 602384
- UniProtKB: O14939
Previous GeneCards Identifiers for PLD2 Gene
- GC17P005137
- GC17P004661
- GC17P004917
- GC17P004657
- GC17P004710
- GC17P004598
Summaries for PLD2 Gene
-
The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]
GeneCards Summary for PLD2 Gene
PLD2 (Phospholipase D2) is a Protein Coding gene. Diseases associated with PLD2 include Tooth Agenesis. Among its related pathways are Translation Translation regulation by Alpha-1 adrenergic receptors and Circadian entrainment. Gene Ontology (GO) annotations related to this gene include phosphatidylinositol binding and N-acylphosphatidylethanolamine-specific phospholipase D activity. An important paralog of this gene is PLD1.
UniProtKB/Swiss-Prot for PLD2 Gene
-
May have a role in signal-induced cytoskeletal regulation and/or endocytosis.
-
Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.
Additional gene information for PLD2 Gene
- Monarch Initiative
- Search for PLD2 at DataMed
- Search for PLD2 at HumanCyc
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLD2 Gene
Genomics for PLD2 Gene
GeneHancer (GH) Regulatory Elements for PLD2 Gene
Regulatory Element Products
Genomic Locations for PLD2 Gene
- chr17:4,807,096-4,823,434
- (GRCh38/hg38)
- Size:
- 16,339 bases
- Orientation:
- Plus strand
- chr17:4,710,391-4,726,729
- (GRCh37/hg19)
Genomic View for PLD2 Gene
- Cytogenetic band:
-
- 17p13.2 by Ensembl
- 17p13.2 by Entrez Gene
- 17p13.2 by HGNC


RefSeq DNA sequence for PLD2 Gene
Proteins for PLD2 Gene
-
Protein details for PLD2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O14939-PLD2_HUMAN
- Recommended name:
- Phospholipase D2
- Protein Accession:
- O14939
- I3L2C9
- O43540
- O43579
- O43580
- Q6PGR0
- Q96BY3
Protein attributes for PLD2 Gene
- Size:
- 933 amino acids
- Molecular mass:
- 105987 Da
- Quaternary structure:
-
- Interacts with EGFR (By similarity). Interacts with PIP5K1B.
Protein Expression for PLD2 Gene
Selected DME Specific Peptides for PLD2 Gene
- O14939:
-
- IGSANIN
- EYQAGRFA
- INSGYSK
- KEVELAL
- YIENQFF
- ARHFIQRWNFTK
- LGKRDSE
- EEIFITDWWLSPE
- DFIDRET
- KDWVQLD
- LPGFEGDISTGGGN
- DLAYGRWDD
- VKDSFLLYM
- LHPNIKVMRHPD
- ASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPD
- EGEDPADRMHP
- AQVVGTERYTSGSKVGTCTLYSVRLTHGDF
- LWAHHEKL
- HPLVFAPGVPV
- CYRWSKRWL
Post-translational modifications for PLD2 Gene
- Phosphorylated by FGR.
Other Protein References for PLD2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for PLD2 (PLD2)
-
Custom Antibody ServicesOriGene Antibodies for PLD2
- Novus Biologicals Antibodies for PLD2
-
Abcam antibodies for PLD2
-
Cloud-Clone Corp. Antibodies for PLD2
- Invitrogen Antibodies for PLD2
- Search GeneTex for Antibodies for PLD2
-
Santa Cruz Biotechnology (SCBT) Antibodies for PLD2
Protein Products
-
OriGene Purified Proteins for PLD2
- Search Origene for MassSpec and Protein Over-expression Lysates for PLD2
- Origene Custom Protein Services for PLD2
- Novus Biologicals proteins for PLD2
-
Cloud-Clone Corp. Proteins for PLD2
- Search GeneTex for Proteins for PLD2
-
Abcam proteins for PLD2
Assay Products
-
Cloud-Clone Corp. Assay Kits for PLD2
Domains & Families for PLD2 Gene
Gene Families for PLD2 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for PLD2 Gene
Suggested Antigen Peptide Sequences for PLD2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
O14939- Family:
-
- Belongs to the phospholipase D family.
Function for PLD2 Gene
Molecular function for PLD2 Gene
- GENATLAS Biochemistry:
- phospholipase D2,106kDa,phosphatidylcholine specific,widely expressed,involved in metabolic regulation,cardiac and brain function,senescence regulated secretion,mitogenesis and cytoskeletal changes
- UniProtKB/Swiss-Prot CatalyticActivity:
- A phosphatidylcholine + H(2)O = choline + a phosphatidate.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Stimulated by phosphatidylinositol 4,5-bisphosphate and activated by the ADP-ribosylation factor-1 (ARF-1).
- UniProtKB/Swiss-Prot Function:
- May have a role in signal-induced cytoskeletal regulation and/or endocytosis.
Enzyme Numbers (IUBMB) for PLD2 Gene
Phenotypes From GWAS Catalog for PLD2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004630 | phospholipase D activity | TAS | -- |
GO:0005515 | protein binding | IPI | 16407827 |
GO:0016787 | hydrolase activity | IEA | -- |
GO:0035091 | phosphatidylinositol binding | IEA | -- |
GO:0070290 | N-acylphosphatidylethanolamine-specific phospholipase D activity | IEA | -- |
Phenotypes for PLD2 Gene
- MGI mutant phenotypes for PLD2:
- inferred from 4 alleles
- GenomeRNAi human phenotypes for PLD2:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Increased shRNA abundance (Z-score > 2)
- Decreased NF-kappaB reporter expression
- Decreased shRNA abundance (Z-score < -2)
- Decreased IL-8 secretion
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased FA abundance
- Decreased influenza A/WSN/33 replication
- Decreased influenza A H1N1 (A/Hamburg/04/2009) virus numbers
- Decreased influenza A H1N1 (A/WSN/33) virus numbers
Animal Models for PLD2 Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for PLD2
-
-
ViGene Biosciences lentiviral particle packaged cDNA for PLD2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for PLD2 gene
- Search ViGene Biosciences for PLD2
CRISPR Products
-
OriGene CRISPR knockouts for PLD2
- Applied Biological Materials CRISPR for PLD2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for PLD2
- GenScript: Design CRISPR guide RNA sequences for PLD2
miRNA for PLD2 Gene
- miRTarBase miRNAs that target PLD2
miRNA Products
- Search ViGene Biosciences for PLD2
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for PLD2
- Browse OriGene Inhibitory RNA Products For PLD2
-
ViGene Biosciences ready-to-package AAV shRNAs for PLD2 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for PLD2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for PLD2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- orf clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- Applied Biological Materials Clones for PLD2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for PLD2
-
ViGene Biosciences adenoviral particle packaged cDNA for PLD2 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for PLD2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for PLD2 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLD2 Gene
Localization for PLD2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for PLD2 Gene
- Membrane; Peripheral membrane protein.
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005789 | endoplasmic reticulum membrane | TAS | -- |
GO:0005794 | Golgi apparatus | IBA | -- |
GO:0005886 | plasma membrane | TAS | -- |
GO:0016020 | membrane | IEA | -- |
GO:0098793 | presynapse | IEA | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for PLD2 Gene
Pathways & Interactions for PLD2 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Glycerophospholipid biosynthesis |
.01
|
|
2 | Metabolism |
.37
|
|
3 | Phospholipase D signaling pathway | ||
4 | Acyl chain remodelling of PE |
.30
|
|
5 | Innate Immune System |
.61
|
Pathways by source for PLD2 Gene
1 Cell Signaling Technology pathway for PLD2 Gene
12 BioSystems pathways for PLD2 Gene
10 Reactome pathways for PLD2 Gene
12 KEGG pathways for PLD2 Gene
1 GeneGo (Thomson Reuters) pathway for PLD2 Gene
8 Qiagen pathways for PLD2 Gene
Interacting Proteins for PLD2 Gene
SIGNOR curated interactions for PLD2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006629 | lipid metabolic process | IEA | -- |
GO:0006654 | phosphatidic acid biosynthetic process | IEA,TAS | -- |
GO:0007010 | cytoskeleton organization | TAS | 9395408 |
GO:0007264 | small GTPase mediated signal transduction | TAS | 9582313 |
GO:0016042 | lipid catabolic process | IEA | -- |
Drugs & Compounds for PLD2 Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
oleic acid | Approved, Investigational, Vet_approved | Pharma | Full agonist, Agonist | 0 | ||
Choline | Approved | Nutra | Target, product of | 176 | ||
Water | Approved | Pharma | 0 | |||
Zinc | Approved, Investigational | Pharma | 2430 | |||
Ethanolamine | Experimental | Pharma | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
PA(16:0/16:0) |
|
7091-44-3 |
|
|||
PA(16:0/18:1(11Z)) |
|
|
||||
PA(16:0/18:1(9Z)) |
|
|
||||
PA(16:0/18:2(9Z,12Z)) |
|
|
||||
PA(18:0/18:2(9Z,12Z)) |
|
|
(5) Tocris Compounds for PLD2 Gene
Compound | Action | Cas Number |
---|---|---|
AACOCF3 | Phospholipase A2 inhibitor | 149301-79-1 |
Edelfosine | Selective PI-PLC inhibitor, also PAF receptor agonist | 77286-66-9 |
m-3M3FBS | Phospholipase C activator | 200933-14-8 |
o-3M3FBS | Inactive analog of m-3M3FBS (Cat. No. 1941) | 313981-55-4 |
U 73122 | Phospholipase C inhibitor | 112648-68-7 |
Transcripts for PLD2 Gene
mRNA/cDNA for PLD2 Gene
- (4) REFSEQ mRNAs :
- (9) Additional mRNA sequences :
- (155) Selected AceView cDNA sequences:
- (15) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for PLD2
- Applied Biological Materials CRISPR for PLD2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for PLD2
- GenScript: Design CRISPR guide RNA sequences for PLD2
miRNA Products
- Search ViGene Biosciences for PLD2
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for PLD2
- Browse OriGene Inhibitory RNA Products For PLD2
-
ViGene Biosciences ready-to-package AAV shRNAs for PLD2 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for PLD2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for PLD2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- orf clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- Applied Biological Materials Clones for PLD2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | · | 1c | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11a | · | 11b | ^ | 12 | ^ | 13 | ^ | 14a | · | 14b | ^ | 15a | · | 15b | · | 15c | ^ | 16 | ^ | 17a | · | 17b | ^ | 18 | ^ | 19a | · |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
SP2: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP7: |
ExUns: | 19b | ^ | 20 | ^ | 21 | ^ | 22 | ^ | 23a | · | 23b | · | 23c | ^ | 24 | ^ | 25a | · | 25b |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | |||||||||||||||||||
SP2: | - | ||||||||||||||||||
SP3: | |||||||||||||||||||
SP4: | |||||||||||||||||||
SP5: | |||||||||||||||||||
SP6: | |||||||||||||||||||
SP7: |
Expression for PLD2 Gene
mRNA differential expression in normal tissues according to GTEx for PLD2 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PLD2 Gene
NURSA nuclear receptor signaling pathways regulating expression of PLD2 Gene:
PLD2SOURCE GeneReport for Unigene cluster for PLD2 Gene:
Hs.104519mRNA Expression by UniProt/SwissProt for PLD2 Gene:
O14939-PLD2_HUMANEvidence on tissue expression from TISSUES for PLD2 Gene
- Nervous system(4.7)
- Skin(4.4)
- Adrenal gland(2)
- Kidney(2)
Primer Products
-
OriGene qPCR primer pairs for PLD2
-
OriGene qPCR primer pairs and template standards for PLD2
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PLD2 Gene
Orthologs for PLD2 Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | PLD2 34 33 |
|
OneToOne | |
cow (Bos Taurus) |
Mammalia | PLD2 34 33 |
|
OneToOne | |
rat (Rattus norvegicus) |
Mammalia | Pld2 33 |
|
||
mouse (Mus musculus) |
Mammalia | Pld2 34 16 33 |
|
OneToOne | |
dog (Canis familiaris) |
Mammalia | PLD2 34 33 |
|
OneToOne | |
oppossum (Monodelphis domestica) |
Mammalia | PLD2 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | PLD2 34 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | -- 34 |
|
ManyToMany | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | pld2 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | pld2 33 34 |
|
||
fruit fly (Drosophila melanogaster) |
Insecta | Pld 35 34 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | pld-1 35 34 |
|
||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | SPO14 34 36 |
|
OneToMany | |
barley (Hordeum vulgare) |
Liliopsida | Hv.2078 33 |
|
||
corn (Zea mays) |
Liliopsida | Zm.50 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany |
- Species where no ortholog for PLD2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for PLD2 Gene
(1) SIMAP similar genes for PLD2 Gene using alignment to 8 proteins:
Variants for PLD2 Gene
SNP ID | Clin | Chr 17 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
VAR_036503 | A breast cancer sample | p.Gln807Glu | |||
rs386352350 | uncertain-significance, not provided | 4,817,011(+) | C/T | coding_sequence_variant, intron_variant, missense_variant, non_coding_transcript_variant | |
rs1000158222 | -- | 4,811,763(+) | G/A | intron_variant | |
rs1000190931 | -- | 4,821,123(+) | C/A/T | intron_variant | |
rs1000257454 | -- | 4,818,935(+) | G/A | intron_variant |
Additional Variant Information for PLD2 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PLD2 Gene
Disorders for PLD2 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
tooth agenesis |
|
|
Additional Disease Information for PLD2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for PLD2 Gene
Publications for PLD2 Gene
- Cloning and initial characterization of a human phospholipase D2 (hPLD2). ADP-ribosylation factor regulates hPLD2. (PMID: 9582313) Lopez I … Lambeth JD (The Journal of biological chemistry 1998) 2 3 4 22 58
- Interaction of the type Ialpha PIPkinase with phospholipase D: a role for the local generation of phosphatidylinositol 4, 5-bisphosphate in the regulation of PLD2 activity. (PMID: 11032811) Divecha N … D'Santos C (The EMBO journal 2000) 3 4 22 58
- Characterization of human PLD2 and the analysis of PLD isoform splice variants. (PMID: 9761774) Steed PM … Lasala DJ (FASEB journal : official publication of the Federation of American Societies for Experimental Biology 1998) 3 4 22 58
- Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 44 58
- Epidermal growth factor increases lysophosphatidic acid production in human ovarian cancer cells: roles for phospholipase D2 and receptor transactivation. (PMID: 19864325) Snider AJ … Meier KE (American journal of physiology. Cell physiology 2010) 3 22 58
Products for PLD2 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for PLD2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for PLD2
- Search Origene for MassSpec and Protein Over-expression Lysates for PLD2
- Origene Custom Protein Services for PLD2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PLD2
- Browse OriGene Inhibitory RNA Products For PLD2
- OriGene qPCR primer pairs and template standards for PLD2
- OriGene qPCR primer pairs for PLD2
- OriGene CRISPR knockouts for PLD2
- OriGene ORF clones in human for PLD2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For PLD2
- GenScript: Next-day shipping of latest version cDNA ORF clones for PLD2 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for PLD2
- GenScript Custom Assay Services for PLD2
- GenScript Custom overexpressing Cell Line Services for PLD2
- GenScript: Design CRISPR guide RNA sequences for PLD2
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for PLD2
- Cell Signaling Technology (CST) Antibodies for PLD2 (PLD2)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for PLD2
- Novus Biologicals proteins for PLD2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for PLD2
- Abcam proteins for PLD2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for PLD2
- Cloud-Clone Corp. Proteins for PLD2
- Cloud-Clone Corp. Assay Kits for PLD2
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for PLD2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for PLD2
- VectorBuilder custom plasmid, inducible vectors for PLD2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for PLD2
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 58 available Phospholipase D2 Antibodies ranked by validation data
- Compare Top Phospholipase D2 Antibodies
- antibodies-online: Search results for 18 available Phospholipase D2 Elisa Kits ranked by validation data
- Compare Top Phospholipase D2 Elisa Kits
- antibodies-online: Search results for 4 available Phospholipase D2 Proteins ranked by validation data
- Compare Top Phospholipase D2 Proteins
- Search GeneTex for Antibodies for PLD2
- Search GeneTex for Proteins for PLD2
- ViGene Biosciences adenoviral particle packaged cDNA for PLD2 gene
- ViGene Biosciences lentiviral particle packaged cDNA for PLD2 gene
- ViGene Biosciences ready-to-package AAV shRNAs for PLD2 gene
- Search ViGene Biosciences for PLD2
- Santa Cruz Biotechnology (SCBT) Antibodies for PLD2
- Search Santa Cruz Biotechnology (SCBT) for PLD2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for PLD2
- Horizon Cell Lines for PLD2
- genomics-online: cdna clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- orf clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- genomics-online: gRNA clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- genomics-online: primer clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
- genomics-online: shRNA clones - Search results for 96 available Phospholipase D2 gene related products
- Overview of 96 available Phospholipase D2 gene related products
Sources for PLD2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew