Aliases for PIK3C3 Gene
Aliases for PIK3C3 Gene
External Ids for PIK3C3 Gene
- HGNC: 8974
- Entrez Gene: 5289
- Ensembl: ENSG00000078142
- OMIM: 602609
- UniProtKB: Q8NEB9
Previous GeneCards Identifiers for PIK3C3 Gene
- GC18P039741
- GC18P039321
- GC18P039423
- GC18P037787
- GC18P037789
- GC18P039535
- GC18P036394
Summaries for PIK3C3 Gene
GeneCards Summary for PIK3C3 Gene
PIK3C3 (Phosphatidylinositol 3-Kinase Catalytic Subunit Type 3) is a Protein Coding gene. Diseases associated with PIK3C3 include Amyotrophic Lateral Sclerosis 1. Among its related pathways are wtCFTR and deltaF508 traffic / Late endosome and Lysosome (norm and CF) and Delta508-CFTR traffic / Sorting endosome formation in CF. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and binding. An important paralog of this gene is PIK3CB.
UniProtKB/Swiss-Prot for PIK3C3 Gene
-
Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (PubMed:20643123, PubMed:20208530). Involved in the transport of lysosomal enzyme precursors to lysosomes. Required for transport from early to late endosomes (By similarity).
-
PI 3-Kinases (phosphoinositide 3-kinases, PI 3-Ks) are a family of lipid kinases capable of phosphorylating the 3'OH of the inositol ring of phosphoinositides. They are responsible for coordinating a diverse range of cell functions including proliferation and survival.
Additional gene information for PIK3C3 Gene
No data available for Entrez Gene Summary , CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PIK3C3 Gene
Genomics for PIK3C3 Gene
GeneHancer (GH) Regulatory Elements for PIK3C3 Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH18I041954 | Promoter/Enhancer | 1.9 | EPDnew Ensembl ENCODE | 558 | +0.5 | 468 | 2.3 | PKNOX1 ATF1 FOXA2 SMAD1 ARID4B SIN3A ZNF2 YY1 ETS1 E2F8 | PIK3C3 GC18M041981 | |
GH18I042113 | Enhancer | 1 | Ensembl ENCODE | 10.5 | +158.9 | 158940 | 1.9 | FOXA2 IRF4 RAD21 RARA YY1 ZNF335 ZNF143 RCOR1 IKZF2 SMARCA5 | PIK3C3 GC18P042131 ENSG00000267088 | |
GH18I041991 | Enhancer | 0.8 | ENCODE | 12.1 | +37.3 | 37276 | 1.2 | HDAC1 PKNOX1 SMAD1 BMI1 BATF IRF4 ATF7 ETV6 IKZF2 RUNX3 | PIK3C3 GC18P041990 GC18P042007 | |
GH18I041937 | Enhancer | 0.9 | FANTOM5 Ensembl ENCODE | 6.5 | -15.6 | -15588 | 4.2 | MEIS2 JUND POLR2A FOS REST | PIK3C3 GC18M041930 | |
GH18I042047 | Enhancer | 0.9 | Ensembl ENCODE | 5.7 | +92.8 | 92847 | 1.8 | ELF3 FOXA2 ZNF792 SAP130 CEBPG FOS FOSL2 HOMEZ MAFK GATAD2A | PIK3C3 ENSG00000276174 GC18P042007 |
Regulatory Element Products
Genomic Locations for PIK3C3 Gene
- chr18:41,955,199-42,087,830
- (GRCh38/hg38)
- Size:
- 132,632 bases
- Orientation:
- Plus strand
- chr18:39,535,171-39,667,794
- (GRCh37/hg19)
Genomic View for PIK3C3 Gene
- Cytogenetic band:
-
- 18q12.3 by Ensembl
- 18q12.3 by Entrez Gene
- 18q12.3 by HGNC


RefSeq DNA sequence for PIK3C3 Gene
Proteins for PIK3C3 Gene
-
Protein details for PIK3C3 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q8NEB9-PK3C3_HUMAN
- Recommended name:
- Phosphatidylinositol 3-kinase catalytic subunit type 3
- Protein Accession:
- Q8NEB9
- Q15134
Protein attributes for PIK3C3 Gene
- Size:
- 887 amino acids
- Molecular mass:
- 101549 Da
- Cofactor:
- Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Component of the PI3K (PI3KC3/PI3K-III/class III phosphatidylinositol 3-kinase) complex the core of which is composed of the catalytic subunit PIK3C3, the regulatory subunit PIK3R4 and BECN1 associating with additional regulatory/auxilliary subunits to form alternative complex forms. Alternative complex forms containing a forth regulatory subunit in a mutually exclusive manner are: the PI3K complex I (PI3KC3-C1) containing ATG14, and the PI3K complex II (PI3KC3-C2) containing UVRAG. PI3KC3-C1 displays a V-shaped architecture with PIK3R4 serving as a bridge between PIK3C3 and the ATG14:BECN1 subcomplex. Both, PI3KC3-C1 and PI3KC3-C2, can associate with further regulatory subunits such as RUBCN, SH3GLB1/Bif-1 and AMBRA1 (PubMed:7628435, PubMed:19050071, PubMed:20643123, PubMed:19270696, PubMed:23878393, PubMed:25490155). PI3KC3-C1 probably associates with PIK3CB (By similarity). Interacts with RAB7A in the presence of PIK3R4 (PubMed:14617358). Interacts with AMBRA1 (By similarity). Interacts with BECN1P1/BECN2 (PubMed:23954414). Interacts with SLAMF1(PubMed:22493499). May be a component of a complex composed of RAB5A (in GDP-bound form), DYN2 and PIK3C3 (By similarity). Interacts with NCKAP1L (PubMed:16417406).
Protein Expression for PIK3C3 Gene
Selected DME Specific Peptides for PIK3C3 Gene
- Q8NEB9:
-
- SNLILNLF
- LTPYKVLAT
- FKTEDGGKYPVIFK
- LEQDLCTFLISRACKNSTLANYLYWYVIVECE
- FSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPG
- KEMVEGMGG
- RDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLA
- ALFAAVVEQIHKFAQYWR
- YSCDLDI
- LFHIDFG
- IPLPLEPQVKIRGIIPE
- TEGSIQNFFRKY
- QADDEDLLMYLLQLVQALKYENF
- KEYGIVYYEKDGDES
- SCAGYCV
- ATLFKSALMPA
- QEAKQALEL
- FRYYLTN
- VDWLDRLTF
- GKLFHIDFGYILG
- QQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKM
- TVSLFGKYGMFRQGMHDLKVWPN
- GDDLRQDQL
- VPDPQMSMENLVE
- VITYILG
Post-translational modifications for PIK3C3 Gene
Other Protein References for PIK3C3 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for PIK3C3 (PIK3C3)
- Novus Biologicals Antibodies for PIK3C3
-
Abcam antibodies for PIK3C3
-
Cloud-Clone Corp. Antibodies for PIK3C3
- Invitrogen Antibodies for PIK3C3
- GeneTex PIK3C3 antibody for PIK3C3
-
Custom Antibody ServicesProSci Antibodies for PIK3C3
-
Santa Cruz Biotechnology (SCBT) Antibodies for PIK3C3
Protein Products
-
OriGene Purified Proteins for PIK3C3
- Search Origene for MassSpec and Protein Over-expression Lysates for PIK3C3
- Origene Custom Protein Services for PIK3C3
-
Cloud-Clone Corp. Proteins for PIK3C3
- Search GeneTex for Proteins for PIK3C3
-
Abcam proteins for PIK3C3
Assay Products
-
Cloud-Clone Corp. Assay Kits for PIK3C3
Domains & Families for PIK3C3 Gene
Gene Families for PIK3C3 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for PIK3C3 Gene
Suggested Antigen Peptide Sequences for PIK3C3 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q8NEB9- Family:
-
- Belongs to the PI3/PI4-kinase family.
Function for PIK3C3 Gene
Molecular function for PIK3C3 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 3-phosphate.
- UniProtKB/Swiss-Prot Function:
- Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (PubMed:20643123, PubMed:20208530). Involved in the transport of lysosomal enzyme precursors to lysosomes. Required for transport from early to late endosomes (By similarity).
Enzyme Numbers (IUBMB) for PIK3C3 Gene
Phenotypes From GWAS Catalog for PIK3C3 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000166 | nucleotide binding | IEA | -- |
GO:0004672 | protein kinase activity | IEA | -- |
GO:0005515 | protein binding | IPI | 7504174 |
GO:0005524 | ATP binding | IEA | -- |
GO:0016301 | kinase activity | IDA,IEA | 25327288 |
Phenotypes for PIK3C3 Gene
- MGI mutant phenotypes for PIK3C3:
-
inferred from 6 alleles
- nervous system phenotype
- normal phenotype
- homeostasis/metabolism phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- vision/eye phenotype
- embryo phenotype
- hematopoietic system phenotype
- liver/biliary system phenotype
- GenomeRNAi human phenotypes for PIK3C3:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Decreased viability in esophageal squamous lineage
- Increased transferrin (TF) endocytosis
- Decreased viability after Maraba virus infection
- Decreased viability
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased FA abundance
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Negative genetic interaction between BLM-/- and BLM+/+
- Increased epidermal growth factor receptor (EGFR) surface abundance
- Upregulation of Wnt/beta-catenin pathway after WNT3A stimulation
- Increased cilium length after serum starvation
- Decreased viability after gemcitabine stimulation
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for PIK3C3 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for PIK3C3 gene
- Search ViGene Biosciences for PIK3C3
CRISPR Products
-
OriGene CRISPR knockouts for PIK3C3
- genomics-online: gRNA clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
- Applied Biological Materials CRISPR for PIK3C3
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for PIK3C3
miRNA for PIK3C3 Gene
- miRTarBase miRNAs that target PIK3C3
-
- hsa-mir-98-5p (MIRT027827)
- hsa-mir-149-5p (MIRT045507)
- hsa-mir-3978 (MIRT497902)
- hsa-mir-4709-3p (MIRT497903)
- hsa-mir-6124 (MIRT497904)
- hsa-mir-3148 (MIRT497905)
- hsa-mir-4699-5p (MIRT497906)
- hsa-mir-4635 (MIRT497907)
- hsa-mir-5579-5p (MIRT497908)
- hsa-mir-5583-3p (MIRT497909)
- hsa-mir-129-5p (MIRT783562)
- hsa-mir-29b-2-5p (MIRT784410)
- hsa-mir-5087 (MIRT787066)
- hsa-mir-659-3p (MIRT788399)
- hsa-mir-8068 (MIRT789794)
miRNA Products
- Search ViGene Biosciences for PIK3C3
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PIK3C3
- Browse OriGene Inhibitory RNA Products For PIK3C3
- genomics-online: shRNA clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for PIK3C3 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for PIK3C3
- Applied Biological Materials Clones for PIK3C3
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for PIK3C3 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for PIK3C3 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for PIK3C3 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PIK3C3 Gene
Localization for PIK3C3 Gene
Subcellular locations from UniProtKB/Swiss-Prot for PIK3C3 Gene
- Midbody. Late endosome. Cytoplasmic vesicle, autophagosome. Note=As component of the PI3K complex I localized to pre-autophagosome structures. As component of the PI3K complex II localized predominantly to endosomes (Probable). Localizes also to discrete punctae along the ciliary axoneme and to the base of the ciliary axoneme (By similarity). {ECO:0000250 UniProtKB:Q6PF93, ECO:0000305 PubMed:14617358}.
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000407 | phagophore assembly site | IBA | -- |
GO:0005622 | intracellular | IEA | -- |
GO:0005768 | endosome | IEA | -- |
GO:0005770 | late endosome | IEA,IDA | 14617358 |
GO:0005776 | autophagosome | IEA | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for PIK3C3 Gene
Pathways & Interactions for PIK3C3 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | RET signaling | ||
2 | Inositol phosphate metabolism (KEGG) | ||
3 | PI Metabolism |
.63
|
|
4 | Autophagy Pathway |
.34
|
|
5 | Metabolism |
.37
|
Pathways by source for PIK3C3 Gene
2 GeneTex pathways for PIK3C3 Gene
3 Cell Signaling Technology pathways for PIK3C3 Gene
8 BioSystems pathways for PIK3C3 Gene
24 Reactome pathways for PIK3C3 Gene
9 KEGG pathways for PIK3C3 Gene
4 GeneGo (Thomson Reuters) pathways for PIK3C3 Gene
1 R&D Systems pathway for PIK3C3 Gene
9 Tocris pathways for PIK3C3 Gene
3 Qiagen pathways for PIK3C3 Gene
Interacting Proteins for PIK3C3 Gene
SIGNOR curated interactions for PIK3C3 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000045 | autophagosome assembly | IBA | -- |
GO:0000910 | cytokinesis | IMP | 20208530 |
GO:0006468 | protein phosphorylation | IBA,IEA | -- |
GO:0006497 | protein lipidation | IMP | 25327288 |
GO:0006661 | phosphatidylinositol biosynthetic process | TAS | -- |
Drugs & Compounds for PIK3C3 Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Manganese | Approved | Nutra | 37 | |||
3-Methyladenine | Experimental | Pharma | Class III PI3K inhibitor, Class III PI 3-kinase inhibitor; also inhibits autophagy | 0 | ||
N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE | Experimental | Pharma | Target | 0 | ||
SF1126 | Investigational | Pharma | inhibitor | Kinase Inhibitors | 0 | |
ATP | Investigational | Nutra | Agonist | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
1D-Myo-inositol 1,3-bisphosphate |
|
103597-56-4 |
|
|
||
1-Phosphatidyl-1D-myo-inositol 3-phosphate |
|
|
||||
1-Phosphatidyl-D-myo-inositol |
|
|
||||
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
Phosphatidylinositol-3,4,5-trisphosphate |
|
|
|
(5) Tocris Compounds for PIK3C3 Gene
Compound | Action | Cas Number |
---|---|---|
3-Methyladenine | Class III PI 3-kinase inhibitor; also inhibits autophagy | 5142-23-4 |
LY 294002 hydrochloride | Prototypical PI 3-kinase inhibitor; also inhibits other kinases | 934389-88-5 |
PI 103 hydrochloride | Inhibitor of PI 3-kinase, mTOR and DNA-PK | 371935-79-4 |
Quercetin | Non-selective PI 3-kinase inhibitor | 117-39-5 |
Wortmannin | Potent, irreversible inhibitor of PI 3-kinase. Also inhibitor of PLK1 | 19545-26-7 |
(2) ApexBio Compounds for PIK3C3 Gene
Compound | Action | Cas Number |
---|---|---|
3-Methyladenine | Class III PI3K inhibitor | 5142-23-4 |
SAR405 | Selective ATP-competitive inhibitor of Vps34 | 1523406-39-4 |
Transcripts for PIK3C3 Gene
mRNA/cDNA for PIK3C3 Gene
- (3) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (138) Selected AceView cDNA sequences:
- (17) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for PIK3C3 Gene
CRISPR Products
-
OriGene CRISPR knockouts for PIK3C3
- genomics-online: gRNA clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
- Applied Biological Materials CRISPR for PIK3C3
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for PIK3C3
miRNA Products
- Search ViGene Biosciences for PIK3C3
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PIK3C3
- Browse OriGene Inhibitory RNA Products For PIK3C3
- genomics-online: shRNA clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for PIK3C3 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for PIK3C3
- Applied Biological Materials Clones for PIK3C3
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | · | 5c | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14a | · | 14b | ^ | 15a | · | 15b | ^ | 16 | ^ | 17 | ^ | 18a | · | 18b | ^ |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP8: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP11: |
ExUns: | 19 | ^ | 20 | ^ | 21 | ^ | 22a | · | 22b | · | 22c | ^ | 23a | · | 23b | · | 23c | ^ | 24 | ^ | 25 | ^ | 26 | ^ | 27a | · | 27b | · | 27c | · | 27d | · | 27e |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | ||||||||||||||||||||||||||||
SP2: | - | - | - | - | - | ||||||||||||||||||||||||||||
SP3: | |||||||||||||||||||||||||||||||||
SP4: | - | ||||||||||||||||||||||||||||||||
SP5: | - | - | - | - | |||||||||||||||||||||||||||||
SP6: | |||||||||||||||||||||||||||||||||
SP7: | - | ||||||||||||||||||||||||||||||||
SP8: | - | - | - | - | - | ||||||||||||||||||||||||||||
SP9: | |||||||||||||||||||||||||||||||||
SP10: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||
SP11: |
Expression for PIK3C3 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PIK3C3 Gene
NURSA nuclear receptor signaling pathways regulating expression of PIK3C3 Gene:
PIK3C3SOURCE GeneReport for Unigene cluster for PIK3C3 Gene:
Hs.464971mRNA Expression by UniProt/SwissProt for PIK3C3 Gene:
Q8NEB9-PK3C3_HUMANEvidence on tissue expression from TISSUES for PIK3C3 Gene
- Nervous system(2.7)
- Muscle(2.4)
- Heart(2.2)
- Liver(2.1)
- Kidney(2)
- Lung(2)
Primer Products
-
OriGene qPCR primer pairs and template standards for PIK3C3
-
OriGene qPCR primer pairs for PIK3C3
- genomics-online: primer clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for PIK3C3 Gene
Orthologs for PIK3C3 Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | PIK3C3 33 34 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | PIK3C3 34 |
|
OneToOne | |
dog (Canis familiaris) |
Mammalia | PIK3C3 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | PIK3C3 33 34 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | PIK3C3 34 |
|
OneToOne | |
mouse (Mus musculus) |
Mammalia | Pik3c3 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Pik3c3 33 |
|
||
chicken (Gallus gallus) |
Aves | PIK3C3 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | PIK3C3 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | pik3c3 33 |
|
||
African clawed frog (Xenopus laevis) |
Amphibia | Xl.11237 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | pik3c3 33 34 |
|
||
wufc13g06 33 |
|
||||
fruit fly (Drosophila melanogaster) |
Insecta | Pi3K59F 35 33 34 |
|
||
African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP010273 33 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | vps-34 35 33 34 |
|
||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | VPS34 33 34 36 |
|
||
K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0D18645g 33 |
|
||
A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AGL113C 33 |
|
||
thale cress (Arabidopsis thaliana) |
eudicotyledons | VPS34 33 |
|
||
soybean (Glycine max) |
eudicotyledons | Gma.2544 33 |
|
||
Alicante grape (Vitis vinifera) |
eudicotyledons | Vvi.9995 33 |
|
||
rice (Oryza sativa) |
Liliopsida | Os05g0180600 33 |
|
||
Os.11111 33 |
|
||||
barley (Hordeum vulgare) |
Liliopsida | Hv.11305 33 |
|
||
wheat (Triticum aestivum) |
Liliopsida | Ta.28795 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | CSA.3927 34 |
|
OneToOne | |
fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | pik3 33 |
|
||
bread mold (Neurospora crassa) |
Ascomycetes | NCU00656 33 |
|
||
sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.5903 33 |
|
- Species where no ortholog for PIK3C3 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
Paralogs for PIK3C3 Gene
(5) SIMAP similar genes for PIK3C3 Gene using alignment to 13 proteins:
Variants for PIK3C3 Gene
SNP ID | Clin | Chr 18 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000029849 | -- | 42,031,412(+) | C/G | intron_variant | |
rs1000036782 | -- | 42,061,701(+) | A/G | intron_variant | |
rs1000047343 | -- | 42,005,670(+) | C/T | intron_variant | |
rs1000081972 | -- | 42,031,055(+) | T/C | intron_variant | |
rs1000122049 | -- | 42,072,413(+) | A/T | intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv3342n100 | CNV | gain | 25217958 |
dgv982e212 | CNV | gain | 25503493 |
esv1001271 | CNV | insertion | 20482838 |
esv1518239 | CNV | deletion | 17803354 |
esv2316444 | CNV | deletion | 18987734 |
esv2674644 | CNV | deletion | 23128226 |
esv2717009 | CNV | deletion | 23290073 |
esv2717010 | CNV | deletion | 23290073 |
esv2717011 | CNV | deletion | 23290073 |
esv2717012 | CNV | deletion | 23290073 |
esv2762006 | CNV | gain | 21179565 |
esv34153 | CNV | loss | 18971310 |
esv3555276 | CNV | deletion | 23714750 |
esv3642321 | CNV | gain | 21293372 |
esv3642341 | CNV | loss | 21293372 |
esv3642342 | CNV | gain | 21293372 |
esv3642345 | CNV | gain | 21293372 |
esv3642346 | CNV | loss | 21293372 |
esv3642347 | CNV | gain | 21293372 |
esv3893097 | CNV | gain | 25118596 |
nsv131226 | CNV | deletion | 16902084 |
nsv507870 | OTHER | sequence alteration | 20534489 |
nsv833631 | CNV | loss | 17160897 |
Additional Variant Information for PIK3C3 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PIK3C3 Gene
Disorders for PIK3C3 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
amyotrophic lateral sclerosis 1 |
|
|
Additional Disease Information for PIK3C3
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for PIK3C3 Gene
Publications for PIK3C3 Gene
- PtdIns(3)P controls cytokinesis through KIF13A-mediated recruitment of FYVE-CENT to the midbody. (PMID: 20208530) Sagona AP … Stenmark H (Nature cell biology 2010) 3 4 22 58
- Human VPS34 and p150 are Rab7 interacting partners. (PMID: 14617358) Stein MP … Wandinger-Ness A (Traffic (Copenhagen, Denmark) 2003) 3 4 22 58
- A human phosphatidylinositol 3-kinase complex related to the yeast Vps34p-Vps15p protein sorting system. (PMID: 7628435) Volinia S … Waterfield MD (The EMBO journal 1995) 2 3 4 58
- Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex. (PMID: 25490155) Baskaran S … Hurley JH (eLife 2014) 3 4 58
- Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism. (PMID: 23954414) He C … Levine B (Cell 2013) 3 4 58
Products for PIK3C3 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for PIK3C3
- Search Origene for MassSpec and Protein Over-expression Lysates for PIK3C3
- Origene Custom Protein Services for PIK3C3
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PIK3C3
- Browse OriGene Inhibitory RNA Products For PIK3C3
- OriGene qPCR primer pairs and template standards for PIK3C3
- OriGene qPCR primer pairs for PIK3C3
- OriGene CRISPR knockouts for PIK3C3
- OriGene ORF clones in human for PIK3C3
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For PIK3C3
- GenScript: Next-day shipping of latest version cDNA ORF clones for PIK3C3 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for PIK3C3
- GenScript Custom Assay Services for PIK3C3
- GenScript Custom overexpressing Cell Line Services for PIK3C3
- Browse GenScript CRISPR for PIK3C3
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for PIK3C3
- Cell Signaling Technology (CST) Antibodies for PIK3C3 (PIK3C3)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for PIK3C3
- Novus Biologicals proteins and lysates for PIK3C3
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for PIK3C3
- Abcam proteins for PIK3C3
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for PIK3C3
- Cloud-Clone Corp. Proteins for PIK3C3
- Cloud-Clone Corp. Assay Kits for PIK3C3
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for PIK3C3
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for PIK3C3
- Addgene plasmids for PIK3C3
- antibodies-online: Search results for 179 available PIK3C3 Antibodies ranked by validation data
- Compare Top PIK3C3 Antibodies
- antibodies-online: Search results for 4 available PIK3C3 Elisa Kits ranked by validation data
- Compare Top PIK3C3 Elisa Kits
- Recommended
- antibodies-online: Search results for 7 available PIK3C3 Proteins ranked by validation data
- Compare Top PIK3C3 Proteins
- GeneTex PIK3C3 antibody for PIK3C3
- Search GeneTex for Proteins for PIK3C3
- ViGene Biosciences adenoviral particle packaged cDNA for PIK3C3 gene
- ViGene Biosciences lentiviral particle packaged cDNA for PIK3C3 gene
- ViGene Biosciences ready-to-package AAV shRNAs for PIK3C3 gene
- Search ViGene Biosciences for PIK3C3
- Santa Cruz Biotechnology (SCBT) Antibodies for PIK3C3
- Search Santa Cruz Biotechnology (SCBT) for PIK3C3 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for PIK3C3
- Custom Antibody ServicesProSci Antibodies for PIK3C3
- Search for PIK3C3 Proteins at ProSci
- genomics-online: cdna clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
- orf clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
- genomics-online: gRNA clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
- genomics-online: primer clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
- genomics-online: shRNA clones - Search results for 98 available PIK3C3 gene related products
- Overview of 98 available PIK3C3 gene related products
Sources for PIK3C3 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew