Free for academic non-profit institutions. Other users need a Commercial license

LIPE Gene(Protein Coding)

Lipase E, Hormone Sensitive Type

GCID:
GC19M042401
GIFtS:
66
Genes Participants
UDN Logo

Aliases for LIPE Gene

Aliases for LIPE Gene

  • Lipase E, Hormone Sensitive Type 2 3 5
  • Lipase, Hormone-Sensitive 2 3
  • EC 3.1.1.79 4 61
  • HSL 3 4
  • Hormone-Sensitive Lipase Testicular Isoform 3
  • Hormone-Sensitive Lipase 3
  • AOMS4 3
  • FPLD6 3
  • LHS 3

External Ids for LIPE Gene

Previous GeneCards Identifiers for LIPE Gene

  • GC19M043552
  • GC19M043297
  • GC19M047581
  • GC19M047597
  • GC19M042906
  • GC19M039335

Summaries for LIPE Gene

Entrez Gene Summary for LIPE Gene

  • The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids. [provided by RefSeq, Jul 2008]

GeneCards Summary for LIPE Gene

LIPE (Lipase E, Hormone Sensitive Type) is a Protein Coding gene. Diseases associated with LIPE include Lipodystrophy, Familial Partial, Type 6 and Hyperlipidemia, Familial Combined. Among its related pathways are Regulation of lipolysis in adipocytes and Regulation of lipid metabolism Insulin signaling-generic cascades. GO annotations related to this gene include protein kinase binding and triglyceride lipase activity.

UniProtKB/Swiss-Prot for LIPE Gene

  • In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.

Gene Wiki entry for LIPE Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for LIPE Gene

Genomics for LIPE Gene

Products:

  1. Regulatory Element

Regulatory Elements for LIPE Gene

Enhancers for LIPE Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH19G042449 1.9 FANTOM5 Ensembl ENCODE dbSUPER 22.1 -22.9 -22904 1.7 PKNOX1 FOXA2 MLX ARNT ARID4B DMAP1 YY1 SLC30A9 ZNF143 ZNF207 LIPE RNU4-60P PSG8 CD177 CEACAM1 CXCL17 PIR51613
GH19G042267 1.9 FANTOM5 ENCODE dbSUPER 6.9 +156.5 156539 6.9 MLX CREB3L1 FEZF1 YBX1 YY1 SLC30A9 ZNF143 ZNF548 ZNF263 SP3 ZNF526 DEDD2 MEGF8 CEACAM3 CIC PAFAH1B3 PRR19 GSK3A ZNF574 TMEM145
GH19G042183 1.3 Ensembl ENCODE dbSUPER 10 +242.5 242534 1.9 HDGF CTCF RB1 SREBF2 TEAD4 RAD21 TEAD3 ZNF766 ZNF316 ZNF143 LOC100505622 DEDD2 ZNF526 LIPE-AS1 LIPE GRIK5 POU2F2 ENSG00000259436
GH19G042419 1.8 FANTOM5 Ensembl ENCODE dbSUPER 6 +4.9 4897 5.3 HDGF PKNOX1 FOXA2 ATF1 ARID4B SIN3A ZNF2 ZNF48 ZNF143 REST CIC LIPE CD177 ENSG00000268605 LIPE-AS1 LOC101930071
GH19G042363 0.9 Ensembl ENCODE 11 +63.6 63582 1.2 PKNOX1 FOXA2 USF1 ZNF114 USF2 FOXA1 RAD51 ZNF169 KLF9 MLLT1 MEGF8 CNFN LIPE-AS1 LIPE GSK3A PIR47672 GC19P042378 MIR8077
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around LIPE on UCSC Golden Path with GeneCards custom track

Transcription factor binding sites by QIAGEN in the LIPE gene promoter:

Genomic Location for LIPE Gene

Chromosome:
19
Start:
42,401,507 bp from pter
End:
42,427,426 bp from pter
Size:
25,920 bases
Orientation:
Minus strand

Genomic View for LIPE Gene

Genes around LIPE on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
LIPE Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for LIPE Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for LIPE Gene

Proteins for LIPE Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for LIPE Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q05469-LIPS_HUMAN
    Recommended name:
    Hormone-sensitive lipase
    Protein Accession:
    Q05469
    Secondary Accessions:
    • Q3LRT2
    • Q6NSL7

    Protein attributes for LIPE Gene

    Size:
    1076 amino acids
    Molecular mass:
    116598 Da
    Quaternary structure:
    • Interacts with PTRF in the adipocyte cytoplasm. Interacts with PLIN5 (By similarity).

    Alternative splice isoforms for LIPE Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for LIPE Gene

Protein Expression for LIPE Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for LIPE Gene

Q05469:
  • QNLDVHFWKAFWNITE
  • ASPSRLLSLMD
  • HGGGFVAQTS
  • PSTPSDVNF
  • ETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFR
  • GDSAGGNL
  • LTVTISPPLAHTGP
  • SIDYSLAPEAPFPRALEECF
  • MDLRTMTQSLV
  • LLPLSVLSKCVS
  • YYAQRLL
  • SHNLAELEAYLAALTQLRA
  • MRRSVSEAALAQP
  • AFFSSQGPGETA

Post-translational modifications for LIPE Gene

  • Phosphorylation by AMPK may block translocation to lipid droplets.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for LIPE Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • R&D Systems Antibodies for LIPE (Hormone-sensitive Lipase/HSL)
  • Cell Signaling Technology (CST) Antibodies for LIPE (HSL)
  • Santa Cruz Biotechnology (SCBT) Antibodies for LIPE

Domains & Families for LIPE Gene

Gene Families for LIPE Gene

HGNC:

Protein Domains for LIPE Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for LIPE Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q05469

UniProtKB/Swiss-Prot:

LIPS_HUMAN :
  • Belongs to the GDXG lipolytic enzyme family.
Family:
  • Belongs to the GDXG lipolytic enzyme family.
genes like me logo Genes that share domains with LIPE: view

Function for LIPE Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for LIPE Gene

GENATLAS Biochemistry:
lipase,hormone sensitive with two isoforms expressed in adipose tissue (HSLadi),testis (HSLtes),associated with obesity and non insulin dependent diabetes
UniProtKB/Swiss-Prot CatalyticActivity:
Diacylglycerol + H(2)O = monoacylglycerol + a carboxylate.
UniProtKB/Swiss-Prot CatalyticActivity:
Triacylglycerol + H(2)O = diacylglycerol + a carboxylate.
UniProtKB/Swiss-Prot CatalyticActivity:
Monoacylglycerol + H(2)O = glycerol + a carboxylate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Rapidly activated by cAMP-dependent phosphorylation under the influence of catecholamines. Dephosphorylation and inactivation are controlled by insulin.
UniProtKB/Swiss-Prot Function:
In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.

Enzyme Numbers (IUBMB) for LIPE Gene

Gene Ontology (GO) - Molecular Function for LIPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004806 triglyceride lipase activity IEA --
GO:0005515 protein binding IPI 17026959
GO:0016298 lipase activity IEA --
GO:0016787 hydrolase activity IEA --
GO:0019901 protein kinase binding IEA --
genes like me logo Genes that share ontologies with LIPE: view
genes like me logo Genes that share phenotypes with LIPE: view

Human Phenotype Ontology for LIPE Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for LIPE Gene

MGI Knock Outs for LIPE:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for miRNA , Transcription Factor Targets and HOMER Transcription for LIPE Gene

Localization for LIPE Gene

Subcellular locations from UniProtKB/Swiss-Prot for LIPE Gene

Cell membrane. Membrane, caveola. Cytoplasm, cytosol. Note=Found in the high-density caveolae. Translocates to the cytoplasm from the caveolae upon insulin stimulation.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for LIPE gene
Compartment Confidence
plasma membrane 5
cytosol 5
nucleus 3
extracellular 2
mitochondrion 2
peroxisome 2
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for LIPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005811 lipid particle IEA,ISS --
GO:0005829 cytosol IDA --
GO:0005886 plasma membrane IEA --
GO:0005901 caveola IEA --
genes like me logo Genes that share ontologies with LIPE: view

Pathways & Interactions for LIPE Gene

genes like me logo Genes that share pathways with LIPE: view

UniProtKB/Swiss-Prot Q05469-LIPS_HUMAN

  • Pathway: Glycerolipid metabolism; triacylglycerol degradation.

SIGNOR curated interactions for LIPE Gene

Is inactivated by:

Gene Ontology (GO) - Biological Process for LIPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation TAS 3420405
GO:0006629 lipid metabolic process IEA --
GO:0008152 metabolic process IEA --
GO:0008202 steroid metabolic process IEA --
GO:0008203 cholesterol metabolic process IEA --
genes like me logo Genes that share ontologies with LIPE: view

Drugs & Compounds for LIPE Gene

Products:

  1. Drug

(35) Drugs for LIPE Gene - From: DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Glycerol Approved, Experimental Pharma 238
Water Approved Pharma 0
cyclic amp Experimental Pharma 0
MYRISTIC ACID Experimental Pharma 0
Palmitic Acid Experimental Pharma Full agonist, Agonist 22

(99) Additional Compounds for LIPE Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
2-Arachidonylglycerol
  • (5Z,8Z,11Z,14Z)-2-hydroxy-1-(hydroxymethyl)ethyl ester 5,8,11,14-Eicosatetraenoate
  • (5Z,8Z,11Z,14Z)-2-hydroxy-1-(hydroxymethyl)ethyl ester 5,8,11,14-Eicosatetraenoic acid
  • (all-Z)-2-hydroxy-1-(hydroxymethyl)ethyl ester 5,8,11,14-Eicosatetraenoate
  • (all-Z)-2-hydroxy-1-(hydroxymethyl)ethyl ester 5,8,11,14-Eicosatetraenoic acid
  • 1-Monoacylglyceride
 53847-30-6
Arachidic acid
  • Arachate
  • Arachic acid
  • Arachidate
  • Arachidic acid
  • Eicosanoate
 506-30-9
Diglycerides Group A
  • 1,2-Dimyristoyl-rac-glycerol
  • DAG(14:0/14:0)
  • DAG(28:0)
  • DG(14:0/14:0)
  • DG(28:0)
Diglycerides Group B
  • 1-Palmitoleoyl-2-arachidonyl-sn-glycerol
  • DAG(16:1/20:0)
  • DAG(16:1n7/20:0)
  • DAG(16:1w7/20:0)
  • DAG(36:1)
Diglycerides Group C
  • 1-Hexadecanoyl-3-(11-eicosenoyl)-sn-glycerol
  • 1-Palmitoyl-3-eicosenoyl-sn-glycerol
  • DAG(16:0/0:0/20:1)
  • DAG(16:0/0:0/20:1n9)
  • DAG(16:0/0:0/20:1w9)
genes like me logo Genes that share compounds with LIPE: view

Transcripts for LIPE Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for LIPE Gene

(7) REFSEQ mRNAs :
(6) Additional mRNA sequences :
(111) Selected AceView cDNA sequences:
(9) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for LIPE Gene

Lipase, hormone-sensitive:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for LIPE Gene

ExUns: 1 ^ 2 ^ 3a · 3b ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10a · 10b ^ 11a · 11b · 11c ^ 12 ^ 13a · 13b · 13c ^ 14
SP1: - - -
SP2: -
SP3: -
SP4:
SP5:
SP6: - - - -
SP7:
SP8: - - - -
SP9: - - -
SP10: -

Relevant External Links for LIPE Gene

GeneLoc Exon Structure for
LIPE
ECgene alternative splicing isoforms for
LIPE

Expression for LIPE Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for LIPE Gene

mRNA expression in normal human tissues for LIPE Gene
mRNA expression by BioGPS for LIPE GenemRNA expression by GTEx for LIPE Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for LIPE Gene

This gene is overexpressed in Adipose - Subcutaneous (x14.8), Adipose - Visceral (Omentum) (x11.2), and Breast - Mammary Tissue (x7.7).

Protein differential expression in normal tissues from HIPED for LIPE Gene

This gene is overexpressed in Adipocyte (47.7) and Nasopharynx (19.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for LIPE Gene



NURSA nuclear receptor signaling pathways regulating expression of LIPE Gene:

LIPE

SOURCE GeneReport for Unigene cluster for LIPE Gene:

Hs.656980

Evidence on tissue expression from TISSUES for LIPE Gene

  • Nervous system(3.7)
  • Muscle(2.4)
  • Adrenal gland(2.2)
  • Blood(2.2)
  • Liver(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for LIPE Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • immune
  • integumentary
  • reproductive
  • skeletal muscle
  • skeleton
Organs:
Head and neck:
  • ear
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • neck
  • skull
Thorax:
  • chest wall
  • clavicle
  • heart
  • rib
  • rib cage
  • scapula
  • sternum
Abdomen:
  • intestine
  • liver
  • pancreas
  • small intestine
Pelvis:
  • ovary
  • pelvis
  • uterus
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • skin
  • spinal column
  • vertebrae
  • white blood cell
genes like me logo Genes that share expression patterns with LIPE: view

Primer Products

No data available for Protein tissue co-expression partners and mRNA Expression by UniProt/SwissProt for LIPE Gene

Orthologs for LIPE Gene

This gene was present in the common ancestor of animals.

Orthologs for LIPE Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia LIPE 34 35
  • 99.26 (n)
cow
(Bos Taurus)
 Mammalia LIPE 34
  • 86.17 (n)
HSL 35
  • 86 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia LIPE 34
  • 83.98 (n)
HSL 35
  • 80 (a)
 OneToOne
mouse
(Mus musculus)
 Mammalia Lipe 34 16 35
  • 81.96 (n)
rat
(Rattus norvegicus)
 Mammalia Lipe 34
  • 78.08 (n)
oppossum
(Monodelphis domestica)
 Mammalia LIPE 35
  • 53 (a)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia LIPE 35
  • 48 (a)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia LIPE 35
  • 65 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia lipe 34
  • 62.34 (n)