Aliases for LIPE Gene
Aliases for LIPE Gene
External Ids for LIPE Gene
- HGNC: 6621
- Entrez Gene: 3991
- Ensembl: ENSG00000079435
- OMIM: 151750
- UniProtKB: Q05469
Previous GeneCards Identifiers for LIPE Gene
- GC19M043552
- GC19M043297
- GC19M047581
- GC19M047597
- GC19M042906
- GC19M039335
Summaries for LIPE Gene
-
The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids. [provided by RefSeq, Jul 2008]
GeneCards Summary for LIPE Gene
LIPE (Lipase E, Hormone Sensitive Type) is a Protein Coding gene. Diseases associated with LIPE include Lipodystrophy, Familial Partial, Type 6 and Lipe-Related Familial Partial Lipodystrophy. Among its related pathways are triacylglycerol degradation and Lipoprotein metabolism. Gene Ontology (GO) annotations related to this gene include protein kinase binding and triglyceride lipase activity.
UniProtKB/Swiss-Prot for LIPE Gene
-
In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.
Additional gene information for LIPE Gene
- Monarch Initiative
- Search for LIPE at DataMed
- Search for LIPE at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for LIPE Gene
Genomics for LIPE Gene
GeneHancer (GH) Regulatory Elements for LIPE Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH19I042427 | Promoter/Enhancer | 0.7 | EPDnew dbSUPER | 550.8 | +0.0 | 18 | 0.1 | LIPE PIR52702 LIPE-AS1 | ||
GH19I042428 | Enhancer | 0.4 | ENCODE dbSUPER | 550.8 | -0.1 | -118 | 0.2 | PIR52702 LIPE GC19P042435 LIPE-AS1 | ||
GH19I042449 | Enhancer | 1.7 | FANTOM5 Ensembl ENCODE dbSUPER | 22.1 | -22.9 | -22903 | 1.7 | PKNOX1 FOXA2 SMAD1 MLX ARNT ARID4B DMAP1 IRF4 YY1 SLC30A9 | LIPE RNU4-60P PSG8 CD177 CEACAM1 CXCL17 PIR51613 LIPE-AS1 | |
GH19I042267 | Promoter/Enhancer | 2.7 | EPDnew FANTOM5 Ensembl ENCODE dbSUPER | 6.9 | +156.5 | 156538 | 6.9 | MLX FEZF1 YBX1 YY1 SLC30A9 E2F8 ZNF143 ZNF548 SP3 NFYC | CIC PIR59110 ZNF526 ZNF574 CCDC97 DEDD2 MEGF8 CEACAM3 PAFAH1B3 PRR19 | |
GH19I042419 | Promoter/Enhancer | 2.1 | FANTOM5 Ensembl ENCODE dbSUPER | 6 | +4.9 | 4897 | 5.3 | HDGF PKNOX1 ATF1 SMAD1 FOXA2 ARID4B SIN3A ZNF2 ZNF48 ZNF143 | CIC LIPE CD177 ENSG00000268605 LOC101930071 LIPE-AS1 |
Regulatory Element Products
Genomic Locations for LIPE Gene
- chr19:42,401,507-42,427,426
- (GRCh38/hg38)
- Size:
- 25,920 bases
- Orientation:
- Minus strand
- chr19:42,905,659-42,931,578
- (GRCh37/hg19)
Genomic View for LIPE Gene
- Cytogenetic band:
-
- 19q13.2 by Ensembl
- 19q13.2 by Entrez Gene
- 19q13.2 by HGNC


RefSeq DNA sequence for LIPE Gene
Proteins for LIPE Gene
-
Protein details for LIPE Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q05469-LIPS_HUMAN
- Recommended name:
- Hormone-sensitive lipase
- Protein Accession:
- Q05469
- Q3LRT2
- Q6NSL7
Protein attributes for LIPE Gene
- Size:
- 1076 amino acids
- Molecular mass:
- 116598 Da
- Quaternary structure:
-
- Interacts with CAVIN1 in the adipocyte cytoplasm (PubMed:17026959). Interacts with PLIN5 (By similarity).
Protein Expression for LIPE Gene
Selected DME Specific Peptides for LIPE Gene
- Q05469:
-
- QNLDVHFWKAFWNITE
- ASPSRLLSLMD
- HGGGFVAQTS
- PSTPSDVNF
- ETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFR
- GDSAGGNL
- LTVTISPPLAHTGP
- SIDYSLAPEAPFPRALEECF
- MDLRTMTQSLV
- LLPLSVLSKCVS
- YYAQRLL
- SHNLAELEAYLAALTQLRA
- MRRSVSEAALAQP
- AFFSSQGPGETA
Post-translational modifications for LIPE Gene
- Phosphorylation by AMPK may block translocation to lipid droplets.
Other Protein References for LIPE Gene
Antibody Products
- R&D Systems Antibodies for LIPE (Hormone-sensitive Lipase/HSL)
- Cell Signaling Technology (CST) Antibodies for LIPE (HSL)
-
Custom Antibody ServicesOriGene Antibodies for LIPE
- Novus Biologicals Antibodies for LIPE
-
Abcam antibodies for LIPE
-
Cloud-Clone Corp. Antibodies for LIPE
- Invitrogen Antibodies for LIPE
- GeneTex LIPE antibody for LIPE
-
Custom Antibody ServicesProSci Antibodies for LIPE
-
Santa Cruz Biotechnology (SCBT) Antibodies for LIPE
Protein Products
-
OriGene Purified Proteins for LIPE
- Search Origene for MassSpec and Protein Over-expression Lysates for LIPE
- Origene Custom Protein Services for LIPE
-
Cloud-Clone Corp. Proteins for LIPE
- Search GeneTex for Proteins for LIPE
-
Abcam proteins for LIPE
Assay Products
-
Cloud-Clone Corp. Assay Kits for LIPE
Domains & Families for LIPE Gene
Gene Families for LIPE Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for LIPE Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for LIPE Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q05469- Family:
-
- Belongs to the GDXG lipolytic enzyme family.
Function for LIPE Gene
Molecular function for LIPE Gene
- GENATLAS Biochemistry:
- lipase,hormone sensitive with two isoforms expressed in adipose tissue (HSLadi),testis (HSLtes),associated with obesity and non insulin dependent diabetes
- UniProtKB/Swiss-Prot CatalyticActivity:
- Diacylglycerol + H(2)O = monoacylglycerol + a carboxylate.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Triacylglycerol + H(2)O = diacylglycerol + a carboxylate.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Monoacylglycerol + H(2)O = glycerol + a carboxylate.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Rapidly activated by cAMP-dependent phosphorylation under the influence of catecholamines. Dephosphorylation and inactivation are controlled by insulin.
- UniProtKB/Swiss-Prot Function:
- In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.
Enzyme Numbers (IUBMB) for LIPE Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004806 | triglyceride lipase activity | IEA | -- |
GO:0005515 | protein binding | IPI | 17026959 |
GO:0016298 | lipase activity | IEA | -- |
GO:0016787 | hydrolase activity | IEA | -- |
GO:0017171 | serine hydrolase activity | IEA | -- |
Phenotypes for LIPE Gene
- MGI mutant phenotypes for LIPE:
-
inferred from 5 alleles
- homeostasis/metabolism phenotype
- muscle phenotype
- cardiovascular system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- digestive/alimentary phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- integument phenotype
- liver/biliary system phenotype
- adipose tissue phenotype
- GenomeRNAi human phenotypes for LIPE:
Animal Models for LIPE Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for LIPE
-
-
ViGene Biosciences lentiviral particle packaged cDNA for LIPE gene
-
ViGene Biosciences ready-to-package AAV shRNAs for LIPE gene
- Search ViGene Biosciences for LIPE
CRISPR Products
-
OriGene CRISPR knockouts for LIPE
- genomics-online: gRNA clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
- Applied Biological Materials CRISPR for LIPE
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for LIPE
- GenScript: Design CRISPR guide RNA sequences for LIPE
miRNA Products
- Search ViGene Biosciences for LIPE
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for LIPE
- Browse OriGene Inhibitory RNA Products For LIPE
- genomics-online: shRNA clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for LIPE gene
Clone Products
- Sino Biological Human cDNA Clone for LIPE
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for LIPE
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIPE
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for LIPE
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for LIPE
-
ViGene Biosciences adenoviral particle packaged cDNA for LIPE gene
-
ViGene Biosciences lentiviral particle packaged cDNA for LIPE gene
-
ViGene Biosciences ready-to-package AAV shRNAs for LIPE gene
No data available for Phenotypes From GWAS Catalog , miRNA , Transcription Factor Targets and HOMER Transcription for LIPE Gene
Localization for LIPE Gene
Subcellular locations from UniProtKB/Swiss-Prot for LIPE Gene
- Cell membrane. Membrane, caveola. Cytoplasm, cytosol. Note=Found in the high-density caveolae. Translocates to the cytoplasm from the caveolae upon insulin stimulation.
- Cytosol (3)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005737 | cytoplasm | IEA | -- |
GO:0005811 | lipid droplet | ISS,IEA | -- |
GO:0005829 | cytosol | IDA | -- |
GO:0005886 | plasma membrane | IEA | -- |
GO:0005901 | caveola | IEA | -- |
Pathways & Interactions for LIPE Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Activation of cAMP-Dependent PKA |
.77
|
.56
|
2 | AMP-activated Protein Kinase (AMPK) Signaling | ||
3 | Regulation of lipid metabolism Insulin signaling-generic cascades | ||
4 | Lipoprotein metabolism | ||
5 | Metabolism |
.37
|
Pathways by source for LIPE Gene
1 Cell Signaling Technology pathway for LIPE Gene
6 BioSystems pathways for LIPE Gene
6 KEGG pathways for LIPE Gene
3 GeneGo (Thomson Reuters) pathways for LIPE Gene
5 Qiagen pathways for LIPE Gene
UniProtKB/Swiss-Prot Q05469-LIPS_HUMAN
- Pathway: Glycerolipid metabolism; triacylglycerol degradation.
Interacting Proteins for LIPE Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | TAS | 3420405 |
GO:0006629 | lipid metabolic process | IEA | -- |
GO:0008152 | metabolic process | IEA | -- |
GO:0008202 | steroid metabolic process | IEA | -- |
GO:0008203 | cholesterol metabolic process | IEA | -- |
Drugs & Compounds for LIPE Gene
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
2-Arachidonylglycerol |
|
53847-30-6 |
|
|||
Arachidic acid |
|
506-30-9 |
|
|||
Diglycerides Group A |
|
|
||||
Diglycerides Group B |
|
|
||||
Diglycerides Group C |
|
|
|
Transcripts for LIPE Gene
mRNA/cDNA for LIPE Gene
- (7) REFSEQ mRNAs :
- (6) Additional mRNA sequences :
- (111) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for LIPE Gene
CRISPR Products
-
OriGene CRISPR knockouts for LIPE
- genomics-online: gRNA clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
- Applied Biological Materials CRISPR for LIPE
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for LIPE
- GenScript: Design CRISPR guide RNA sequences for LIPE
miRNA Products
- Search ViGene Biosciences for LIPE
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for LIPE
- Browse OriGene Inhibitory RNA Products For LIPE
- genomics-online: shRNA clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for LIPE gene
Clone Products
- Sino Biological Human cDNA Clone for LIPE
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for LIPE
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIPE
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for LIPE
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1 | ^ | 2 | ^ | 3a | · | 3b | ^ | 4 | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11a | · | 11b | · | 11c | ^ | 12 | ^ | 13a | · | 13b | · | 13c | ^ | 14 |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | ||||||||||||||||||||||||||||||||||||||||
SP2: | - | ||||||||||||||||||||||||||||||||||||||||||
SP3: | - | ||||||||||||||||||||||||||||||||||||||||||
SP4: | |||||||||||||||||||||||||||||||||||||||||||
SP5: | |||||||||||||||||||||||||||||||||||||||||||
SP6: | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
SP7: | |||||||||||||||||||||||||||||||||||||||||||
SP8: | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
SP9: | - | - | - | ||||||||||||||||||||||||||||||||||||||||
SP10: | - |
Expression for LIPE Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Adipose (Muscoskeletal System)
- Brain (Nervous System)
-
Heart (Cardiovascular System)
- Primitive Heart Tube Cells Primitive Heart Tube
-
Testis (Reproductive System)
- Leydig Cells Testis Interstitium
- Intestine (Gastrointestinal Tract)
mRNA differential expression in normal tissues according to GTEx for LIPE Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for LIPE Gene
NURSA nuclear receptor signaling pathways regulating expression of LIPE Gene:
LIPESOURCE GeneReport for Unigene cluster for LIPE Gene:
Hs.656980Evidence on tissue expression from TISSUES for LIPE Gene
- Nervous system(3.7)
- Muscle(2.5)
- Adrenal gland(2.2)
- Blood(2.2)
- Liver(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for LIPE Gene
- ectoderm
- endoderm
- mesoderm
- cardiovascular
- digestive
- immune
- integumentary
- reproductive
- skeletal muscle
- skeleton
- ear
- head
- jaw
- mandible
- maxilla
- mouth
- neck
- skull
- chest wall
- clavicle
- heart
- rib
- rib cage
- scapula
- sternum
- intestine
- liver
- pancreas
- small intestine
- ovary
- pelvis
- uterus
- ankle
- arm
- digit
- elbow
- femur
- fibula
- finger
- foot
- forearm
- hand
- hip
- humerus
- knee
- lower limb
- radius
- shin
- shoulder
- thigh
- tibia
- toe
- ulna
- upper limb
- wrist
- blood
- blood vessel
- skin
- spinal column
- vertebrae
- white blood cell
Primer Products
-
OriGene qPCR primer pairs for LIPE
- genomics-online: primer clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
No data available for Protein tissue co-expression partners and mRNA Expression by UniProt/SwissProt for LIPE Gene
Orthologs for LIPE Gene
This gene was present in the common ancestor of animals.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | LIPE 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | LIPE 33 |
|
||
HSL 34 |
|
OneToOne | |||
dog (Canis familiaris) |
Mammalia | LIPE 33 |
|
||
HSL 34 |
|
OneToOne | |||
mouse (Mus musculus) |
Mammalia | Lipe 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Lipe 33 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | LIPE 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | LIPE 34 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | LIPE 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | lipe 33 |
|
||
African clawed frog (Xenopus laevis) |
Amphibia | Xl.18619 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | lipeb 33 34 |
|
||
lipea 34 |
|
OneToMany | |||
Dr.14982 33 |
|
||||
rainbow trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.13588 33 |
|
||
fruit fly (Drosophila melanogaster) |
Insecta | CG11055 35 34 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | C46C11.1 35 |
|
|
|
hosl-1 34 |
|
OneToOne | |||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany | |
CSA.8706 34 |
|
OneToMany |
- Species where no ortholog for LIPE was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for LIPE Gene
No data available for Paralogs for LIPE Gene
Variants for LIPE Gene
SNP ID | Clin | Chr 19 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs587777699 | conflicting-interpretations-of-pathogenicity, Familial partial lipodystrophy 6 | 42,401,822(-) | CCCCCGCAGCCCCCGTCTACCCCCGCAGCCCCCGTCT/CCCCCGCAGCCCCCGTCT | coding_sequence_variant, frameshift | |
VAR_036539 | A breast cancer sample | p.Pro146Gln | |||
rs34623222 | likely-benign, not specified | 42,410,613(-) | G/A | coding_sequence_variant, synonymous_variant | |
rs370837760 | likely-benign, not specified | 42,402,058(-) | G/A | coding_sequence_variant, synonymous_variant | |
rs112497256 | uncertain-significance, not specified | 42,410,728(-) | C/A/T | coding_sequence_variant, missense_variant |
Additional Variant Information for LIPE Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for LIPE Gene
Disorders for LIPE Gene

(10) MalaCards diseases for LIPE Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards
Disorder | Aliases | PubMed IDs |
---|---|---|
lipodystrophy, familial partial, type 6 |
|
|
lipe-related familial partial lipodystrophy |
|
|
lipodystrophy |
|
|
hyperlipidemia, familial combined |
|
|
lipomatosis |
|
|
UniProtKB/Swiss-Prot
LIPS_HUMAN- Lipodystrophy, familial partial, 6 (FPLD6) [MIM:615980]: A form of lipodystrophy characterized by abnormal subcutaneous fat distribution. Affected individuals have increased visceral fat, impaired lipolysis, dyslipidemia, hepatic steatosis, systemic insulin resistance, and diabetes. Some patients manifest muscular dystrophy. {ECO:0000269 PubMed:24848981}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for LIPE
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for LIPE Gene
Publications for LIPE Gene
- Gene organization and primary structure of human hormone-sensitive lipase: possible significance of a sequence homology with a lipase of Moraxella TA144, an antarctic bacterium. (PMID: 8506334) Langin D … Holm C (Proceedings of the National Academy of Sciences of the United States of America 1993) 2 3 4 22 58
- Blunted beta-adrenoceptor-mediated fat oxidation in overweight subjects: a role for the hormone-sensitive lipase gene. (PMID: 18249203) Jocken JW … Saris WH (Metabolism: clinical and experimental 2008) 3 22 44 58
- The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension. (PMID: 17318300) Bernard N … Giguère Y (Journal of human genetics 2007) 3 22 44 58
- Association and insulin regulated translocation of hormone-sensitive lipase with PTRF. (PMID: 17026959) Aboulaich N … Strålfors P (Biochemical and biophysical research communications 2006) 3 4 22 58
- Investigation into the role of the hormone sensitive lipase -60C>G promoter variant in morbid obesity. (PMID: 15871848) Talmud PJ … Beisiegel U (Nutrition, metabolism, and cardiovascular diseases : NMCD 2005) 3 22 44 58
Products for LIPE Gene
- R&D Systems Antibodies for LIPE (Hormone-sensitive Lipase/HSL)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for LIPE
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for LIPE
- Search Origene for MassSpec and Protein Over-expression Lysates for LIPE
- Origene Custom Protein Services for LIPE
- Origene shrna, sirna, and RNAi products in human, mouse, rat for LIPE
- Browse OriGene Inhibitory RNA Products For LIPE
- OriGene qPCR primer pairs for LIPE
- OriGene CRISPR knockouts for LIPE
- OriGene ORF clones in human for LIPE
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For LIPE
- GenScript: Next-day shipping of latest version cDNA ORF clones for LIPE in any vector
- GenScript Custom Purified and Recombinant Proteins Services for LIPE
- GenScript Custom Assay Services for LIPE
- GenScript Custom overexpressing Cell Line Services for LIPE
- GenScript: Design CRISPR guide RNA sequences for LIPE
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for LIPE
- Cell Signaling Technology (CST) Antibodies for LIPE (HSL)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for LIPE
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for LIPE
- Novus Biologicals lysates and proteins for LIPE
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for LIPE
- Abcam proteins for LIPE
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for LIPE
- Cloud-Clone Corp. Proteins for LIPE
- Cloud-Clone Corp. Assay Kits for LIPE
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for LIPE
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for LIPE
- VectorBuilder custom plasmid, inducible vectors for LIPE
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIPE
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 126 available LIPE Antibodies ranked by validation data
- Compare Top LIPE Antibodies
- antibodies-online: Search results for 52 available LIPE Elisa Kits ranked by validation data
- Compare Top LIPE Elisa Kits
- antibodies-online: Search results for 3 available LIPE Proteins ranked by validation data
- Compare Top LIPE Proteins
- GeneTex LIPE antibody for LIPE
- Search GeneTex for Proteins for LIPE
- ViGene Biosciences adenoviral particle packaged cDNA for LIPE gene
- ViGene Biosciences lentiviral particle packaged cDNA for LIPE gene
- ViGene Biosciences ready-to-package AAV shRNAs for LIPE gene
- Search ViGene Biosciences for LIPE
- Santa Cruz Biotechnology (SCBT) Antibodies for LIPE
- Search Santa Cruz Biotechnology (SCBT) for LIPE siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for LIPE
- Custom Antibody ServicesProSci Antibodies for LIPE
- Search for LIPE Proteins at ProSci
- Horizon Cell Lines for LIPE
- genomics-online: cdna clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
- orf clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
- genomics-online: gRNA clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
- genomics-online: primer clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
- genomics-online: shRNA clones - Search results for 89 available LIPE gene related products
- Overview of 89 available LIPE gene related products
Sources for LIPE Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28)