Free for academic non-profit institutions. Other users need a Commercial license

Aliases for GUCY1B3 Gene

Aliases for GUCY1B3 Gene

  • Guanylate Cyclase 1 Soluble Subunit Beta 2 3 5
  • Guanylate Cyclase Soluble Subunit Beta-3 3 4
  • Soluble Guanylate Cyclase Small Subunit 3 4
  • Guanylate Cyclase 1, Soluble, Beta 3 2 3
  • GCS-Beta-1 3 4
  • GCS-Beta-3 3 4
  • EC 4.6.1.2 4 61
  • GUCY1B1 3 4
  • GUC1B3 3 4
  • GUCSB3 3 4
  • Guanylate Cyclase Soluble Subunit Beta-1 3
  • GC-S-Beta-1 3
  • GC-SB3 3
  • GUCB3 3

External Ids for GUCY1B3 Gene

Previous HGNC Symbols for GUCY1B3 Gene

  • GUC1B3

Previous GeneCards Identifiers for GUCY1B3 Gene

  • GC04P157568
  • GC04P157108
  • GC04P157257
  • GC04P157246
  • GC04P157037
  • GC04P156888
  • GC04P156680
  • GC04P152419

Summaries for GUCY1B3 Gene

Entrez Gene Summary for GUCY1B3 Gene

  • This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

GeneCards Summary for GUCY1B3 Gene

GUCY1B3 (Guanylate Cyclase 1 Soluble Subunit Beta) is a Protein Coding gene. Among its related pathways are Signaling in Gap Junctions and Vascular smooth muscle contraction. GO annotations related to this gene include protein heterodimerization activity and GTP binding. An important paralog of this gene is GUCY1A2.

UniProtKB/Swiss-Prot for GUCY1B3 Gene

  • Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.

Tocris Summary for GUCY1B3 Gene

  • Guanylyl Cyclases (GC) are a group of enzymes that, in the presence of a metal ion co-factor such as Mg2+ or Mn2+, convert guanosine-5'-triphosphate (GTP) into 3',5'-guanosine monophosphate (cGMP) and pyrophosphate. There are two main groups of guanylyl cyclase.

Gene Wiki entry for GUCY1B3 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GUCY1B3 Gene

Genomics for GUCY1B3 Gene

Regulatory Elements for GUCY1B3 Gene

Enhancers for GUCY1B3 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH04G155675 1.4 Ensembl ENCODE dbSUPER 11.2 -82.7 -82657 1.5 PKNOX1 INSM2 FEZF1 ZNF2 ZNF366 ZSCAN5C SCRT2 ZNF391 OVOL3 TSHZ1 GUCY1B3 GUCY1A3 ENSG00000260244
GH04G155679 0.8 dbSUPER 11.4 -77.9 -77933 3.4 ZSCAN4 ZNF121 ZNF366 ZSCAN5C ZNF350 ZNF600 PRDM10 L3MBTL2 ZNF10 GFI1B GUCY1B3 GUCY1A3 ENSG00000260244
GH04G155628 0.8 Ensembl ENCODE 10.7 -129.5 -129520 1.8 PRDM6 JUN IKZF1 GFI1B MLLT1 EP300 GUCY1B3 GUCY1A3 LOC105377504
GH04G155525 0.7 Ensembl ENCODE 10.8 -232.3 -232261 1.4 PRDM1 NR2F2 GUCY1B3 GUCY1A3 LOC105377504
GH04G155683 0.6 dbSUPER 11.4 -74.5 -74483 2.0 FOXM1 PKNOX1 CTBP1 PRDM6 ZNF680 MAFK GUCY1B3 GUCY1A3 ENSG00000260244
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around GUCY1B3 on UCSC Golden Path with GeneCards custom track

Promoters for GUCY1B3 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000175189 627 1600 HDGF PKNOX1 GLI4 ZNF2 RAD21 ZBTB40 RFX5 GLIS2 EGR1 ZNF143

Genomic Location for GUCY1B3 Gene

Chromosome:
4
Start:
155,758,973 bp from pter
End:
155,807,642 bp from pter
Size:
48,670 bases
Orientation:
Plus strand

Genomic View for GUCY1B3 Gene

Genes around GUCY1B3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GUCY1B3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GUCY1B3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GUCY1B3 Gene

Proteins for GUCY1B3 Gene

  • Protein details for GUCY1B3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q02153-GCYB1_HUMAN
    Recommended name:
    Guanylate cyclase soluble subunit beta-1
    Protein Accession:
    Q02153
    Secondary Accessions:
    • B7Z426
    • Q86WY5

    Protein attributes for GUCY1B3 Gene

    Size:
    619 amino acids
    Molecular mass:
    70514 Da
    Cofactor:
    Name=heme; Xref=ChEBI:CHEBI:30413;
    Quaternary structure:
    • The active enzyme is formed by a heterodimer of an alpha and a beta subunit. Heterodimer with GUCY1A3 (PubMed:1352257, PubMed:23505436, PubMed:24669844). Can also form inactive homodimers in vitro (PubMed:23505436, PubMed:24669844).
    Miscellaneous:
    • There are two types of guanylate cyclases: soluble forms and membrane-associated receptor forms.

    Three dimensional structures from OCA and Proteopedia for GUCY1B3 Gene

    Alternative splice isoforms for GUCY1B3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for GUCY1B3 Gene

Selected DME Specific Peptides for GUCY1B3 Gene

Q02153:
  • GESVQIT
  • LKGQMIY
  • FHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEET
  • EECDHTQFLIEEKESKEEDFYEDLDRFEENGTQ
  • LLNDLYT
  • RGLYLSDIP
  • MPRYCLFG

Post-translational modifications for GUCY1B3 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cloud-Clone Corp. Antibodies for GUCY1B3
  • Santa Cruz Biotechnology (SCBT) Antibodies for GUCY1B3

Domains & Families for GUCY1B3 Gene

Gene Families for GUCY1B3 Gene

Graphical View of Domain Structure for InterPro Entry

Q02153

UniProtKB/Swiss-Prot:

GCYB1_HUMAN :
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Family:
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
genes like me logo Genes that share domains with GUCY1B3: view

Function for GUCY1B3 Gene

Molecular function for GUCY1B3 Gene

GENATLAS Biochemistry:
guanylate cyclase,soluble,beta-1 subunit,73kDa,heterodimerizing with GUCY1A3,preferentially expressed in lung and brain
UniProtKB/Swiss-Prot CatalyticActivity:
GTP = 3,5-cyclic GMP + diphosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by nitric oxide in the presence of magnesium or manganese ions.
UniProtKB/Swiss-Prot Function:
Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.

Enzyme Numbers (IUBMB) for GUCY1B3 Gene

Gene Ontology (GO) - Molecular Function for GUCY1B3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004016 NOT adenylate cyclase activity IBA,IEA --
GO:0004383 guanylate cyclase activity IEA,IDA 23505436
GO:0004872 receptor activity TAS 9742212
GO:0005515 protein binding IPI 23505436
GO:0005525 GTP binding IEA --
genes like me logo Genes that share ontologies with GUCY1B3: view
genes like me logo Genes that share phenotypes with GUCY1B3: view

Animal Models for GUCY1B3 Gene

MGI Knock Outs for GUCY1B3:

Animal Model Products

CRISPR Products

miRNA for GUCY1B3 Gene

miRTarBase miRNAs that target GUCY1B3

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for GUCY1B3 Gene

Localization for GUCY1B3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for GUCY1B3 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GUCY1B3 gene
Compartment Confidence
cytosol 5
plasma membrane 4
cytoskeleton 1
mitochondrion 1
nucleus 1

Gene Ontology (GO) - Cellular Components for GUCY1B3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm IEA --
GO:0005886 plasma membrane IBA --
GO:0008074 guanylate cyclase complex, soluble IDA 23505436
GO:0043234 protein complex IEA --
genes like me logo Genes that share ontologies with GUCY1B3: view

Pathways & Interactions for GUCY1B3 Gene

genes like me logo Genes that share pathways with GUCY1B3: view

Gene Ontology (GO) - Biological Process for GUCY1B3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006171 cAMP biosynthetic process IEA --
GO:0006182 cGMP biosynthetic process IDA,IEA 23505436
GO:0007263 nitric oxide mediated signal transduction TAS 9742212
GO:0008015 blood circulation TAS 9742212
GO:0009190 cyclic nucleotide biosynthetic process IEA --
genes like me logo Genes that share ontologies with GUCY1B3: view

No data available for SIGNOR curated interactions for GUCY1B3 Gene

Drugs & Compounds for GUCY1B3 Gene

(15) Drugs for GUCY1B3 Gene - From: ApexBio, DGIdb, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Riociguat Approved Pharma Soluble guanylate cyclase (sGC) stimulator 0
Phosphoric acid Approved Pharma 0
Manganese Approved Nutra 34
Cyclic GMP Experimental Pharma 0
Guanosine triphosphate Experimental Pharma 0

(1) Additional Compounds for GUCY1B3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8

(4) Tocris Compounds for GUCY1B3 Gene

Compound Action Cas Number
A 350619 hydrochloride Soluble guanylyl cyclase (sGC) activator 1217201-17-6
Guanylin (human) Endogenous activator of intestinal guanylyl cyclase 183200-12-6
NS 2028 Potent soluble guanylyl cyclase (sGC) inhibitor 204326-43-2
Zinc protoporphyrin IX Heme oxygenase and guanylyl cyclase inhibitor 15442-64-5

(8) ApexBio Compounds for GUCY1B3 Gene

Compound Action Cas Number
A 350619 hydrochloride Activator of soluble guanylyl cyclase (sGC) 1217201-17-6
BAY 41-2272 Activator of soluble guanylyl cyclase (sGC) 256376-24-6
BPIPP 325746-94-9
CFM 1571 hydrochloride sGC activator 1215548-30-3
Cinaciguat Soluble guanylate cyclase (sGC) activators 329773-35-5
Guanylin (human) 183200-12-6
NS 2028 204326-43-2
Riociguat Soluble guanylate cyclase (sGC) stimulator 625115-55-1
genes like me logo Genes that share compounds with GUCY1B3: view

Drug Products

Transcripts for GUCY1B3 Gene

Unigene Clusters for GUCY1B3 Gene

Guanylate cyclase 1, soluble, beta 3:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for GUCY1B3 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5a · 5b ^ 6a · 6b · 6c ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13 ^ 14a · 14b
SP1: - - -
SP2: - - - -
SP3: - - - -
SP4: - - -
SP5: - - - -
SP6: -
SP7:

Relevant External Links for GUCY1B3 Gene

GeneLoc Exon Structure for
GUCY1B3
ECgene alternative splicing isoforms for
GUCY1B3

Expression for GUCY1B3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for GUCY1B3 Gene

mRNA differential expression in normal tissues according to GTEx for GUCY1B3 Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x4.0).

Protein differential expression in normal tissues from HIPED for GUCY1B3 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (19.8), Platelet (9.2), Frontal cortex (8.8), and Fetal gut (6.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GUCY1B3 Gene



NURSA nuclear receptor signaling pathways regulating expression of GUCY1B3 Gene:

GUCY1B3

SOURCE GeneReport for Unigene cluster for GUCY1B3 Gene:

Hs.77890

mRNA Expression by UniProt/SwissProt for GUCY1B3 Gene:

Q02153-GCYB1_HUMAN
Tissue specificity: Detected in brain cortex and cerebellum (at protein level).

Evidence on tissue expression from TISSUES for GUCY1B3 Gene

  • Nervous system(4.9)
  • Kidney(4.4)
  • Lung(4.4)
  • Eye(2.1)
genes like me logo Genes that share expression patterns with GUCY1B3: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for GUCY1B3 Gene

Orthologs for GUCY1B3 Gene

This gene was present in the common ancestor of animals.

Orthologs for GUCY1B3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GUCY1B3 34 35
  • 99.78 (n)
cow
(Bos Taurus)
Mammalia GUCY1B1 35
  • 99 (a)
OneToOne
GUCY1B3 34
  • 90.41 (n)
oppossum
(Monodelphis domestica)
Mammalia GUCY1B3 35
  • 98 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GUCY1B3 35
  • 97 (a)
OneToOne
dog
(Canis familiaris)
Mammalia GUCY1B3 34 35
  • 92.84 (n)
mouse
(Mus musculus)
Mammalia Gucy1b3 34 16 35
  • 88.69 (n)
rat
(Rattus norvegicus)
Mammalia Gucy1b3 34
  • 88.42 (n)
chicken
(Gallus gallus)
Aves GUCY1B3 34 35
  • 83.98 (n)
lizard
(Anolis carolinensis)
Reptilia GUCY1B3 35
  • 97 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia gucy1b3 34
  • 80.53 (n)
zebrafish
(Danio rerio)
Actinopterygii gucy1b3 34 35
  • 77.21 (n)
fruit fly
(Drosophila melanogaster)
Insecta Gycbeta100B 34 35
  • 58.57 (n)
Gycbgr100B 36
  • 58 (a)
CG14886 36
  • 37 (a)
CG4154 36
  • 35 (a)
CG14885 36
  • 28 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000214 34
  • 57.91 (n)
worm
(Caenorhabditis elegans)
Secernentea gcy-34 36 34
  • 48.04 (n)
gcy-31 36 35
  • 36 (a)
gcy-35 36
  • 34 (a)
gcy-32 36
  • 33 (a)
gcy-37 36 35
  • 29 (a)
gcy-33 35
  • 18 (a)
OneToMany
acy-3 35
  • 9 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 51 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.13250 34
Species where no ortholog for GUCY1B3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GUCY1B3 Gene

ENSEMBL:
Gene Tree for GUCY1B3 (if available)
TreeFam:
Gene Tree for GUCY1B3 (if available)

Paralogs for GUCY1B3 Gene

Paralogs for GUCY1B3 Gene

(7) SIMAP similar genes for GUCY1B3 Gene using alignment to 5 proteins:

Pseudogenes.org Pseudogenes for GUCY1B3 Gene

genes like me logo Genes that share paralogs with GUCY1B3: view

Variants for GUCY1B3 Gene

Sequence variations from dbSNP and Humsavar for GUCY1B3 Gene

SNP ID Clin Chr 04 pos Sequence Context AA Info Type
rs1000028198 -- 155,767,712(+) CTTGG(C/T)AGCTC intron-variant
rs1000181745 -- 155,789,242(+) TGCTT(A/C)TGTTT intron-variant
rs1000214956 -- 155,795,901(+) TTTAG(A/G)TAGTG intron-variant
rs1000241336 -- 155,788,301(+) TCAGC(A/G)GGCAG intron-variant
rs10003470 -- 155,788,060(+) ttgct(A/G)ccata intron-variant

Structural Variations from Database of Genomic Variants (DGV) for GUCY1B3 Gene

Variant ID Type Subtype PubMed ID
nsv1029122 CNV gain 25217958
nsv521382 CNV loss 19592680
nsv818286 CNV gain 17921354

Variation tolerance for GUCY1B3 Gene

Residual Variation Intolerance Score: 17% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.21; 24.39% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for GUCY1B3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
GUCY1B3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GUCY1B3 Gene

Disorders for GUCY1B3 Gene

Relevant External Links for GUCY1B3

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
GUCY1B3

No disorders were found for GUCY1B3 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for GUCY1B3 Gene

Publications for GUCY1B3 Gene

  1. Molecular cloning of the cDNAs coding for the two subunits of soluble guanylyl cyclase from human brain. (PMID: 1352257) Giuili G. … Guellaeen G. (FEBS Lett. 1992) 2 3 4 64
  2. Crystal structures of the catalytic domain of human soluble guanylate cyclase. (PMID: 23505436) Allerston C.K. … Gileadi O. (PLoS ONE 2013) 3 4 64
  3. Soluble guanylate cyclase beta1-subunit expression is increased in mononuclear cells from patients with erectile dysfunction. (PMID: 16528291) Mateos-CA!ceres P.J. … LA^pez-FarrAc A.J. (Int. J. Impot. Res. 2006) 3 22 64
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  5. Heterogeneity in human soluble guanylate cyclase due to alternative splicing. (PMID: 1680753) Chhajilani V. … Wikberg J.E.S. (FEBS Lett. 1991) 3 4 64

Products for GUCY1B3 Gene

Sources for GUCY1B3 Gene

Content
Loading form....