Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DAPK2 Gene

Aliases for DAPK2 Gene

  • Death Associated Protein Kinase 2 2 3 5
  • DAP Kinase 2 3 4
  • EC 2.7.11.1 4 61
  • DRP-1 3 4
  • DAP-Kinase-Related Protein 1 Beta Isoform 3
  • Death-Associated Protein Kinase 2 3
  • DAP-Kinase-Related Protein 1 4
  • EC 2.7.11 61
  • DRP1 3

External Ids for DAPK2 Gene

Previous GeneCards Identifiers for DAPK2 Gene

  • GC15M059986
  • GC15M057358
  • GC15M061778
  • GC15M061915
  • GC15M061986
  • GC15M064199
  • GC15M041023

Summaries for DAPK2 Gene

Entrez Gene Summary for DAPK2 Gene

  • This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated protein kinase 1 (DAPK1), a positive regulator of programmed cell death. Overexpression of this gene was shown to induce cell apoptosis. It uses multiple polyadenylation sites. [provided by RefSeq, Jul 2008]

GeneCards Summary for DAPK2 Gene

DAPK2 (Death Associated Protein Kinase 2) is a Protein Coding gene. Among its related pathways are Dimerization of procaspase-8 and CDK-mediated phosphorylation and removal of Cdc6. GO annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is DAPK1.

UniProtKB/Swiss-Prot for DAPK2 Gene

  • Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Acts as a mediator of anoikis and a suppressor of beta-catenin-dependent anchorage-independent growth of malignant epithelial cells. May play a role in granulocytic maturation (PubMed:17347302). Regulates granulocytic motility by controlling cell spreading and polarization (PubMed:24163421).

  • Isoform 2 is not regulated by calmodulin. It can phosphorylate MYL9. It can induce membrane blebbing and autophagic cell death.

Gene Wiki entry for DAPK2 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DAPK2 Gene

Genomics for DAPK2 Gene

Regulatory Elements for DAPK2 Gene

Enhancers for DAPK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH15G063891 2 FANTOM5 Ensembl ENCODE dbSUPER 26.2 +177.5 177529 6.8 HDGF PKNOX1 FOXA2 CREB3L1 ARNT WRNIP1 SIN3A FEZF1 ZNF2 ZNF766 DAPK2 HERC1 TRIP4 MIR422A ENSG00000259498 USP3-AS1 RPS27L USP3 ENSG00000275785 LOC101928988
GH15G063984 1.6 FANTOM5 Ensembl ENCODE dbSUPER 32.5 +85.4 85353 3.7 HDAC1 PKNOX1 ZSCAN4 ZBTB40 RARA ZNF121 GATA2 RELB ETV6 IKZF2 DAPK2 HERC1 MIR422A USP3 TRIP4 LOC101928988
GH15G063912 1.4 Ensembl ENCODE dbSUPER 29.6 +157.1 157059 4.3 PKNOX1 NFRKB KLF17 RAD21 KAT2B TCF12 ZNF366 SCRT2 ZNF143 EGR2 DAPK2 HERC1 LOC101928988 SNX1 ENSG00000259498 SNX22 TPM1 ENSG00000275785
GH15G063967 1.4 Ensembl ENCODE dbSUPER 26.6 +101.4 101363 6.7 HDGF TBP TBL1XR1 WRNIP1 RAD21 CHAMP1 YY1 ZNF143 RELB ETV6 DAPK2 PPIB LOC101928988
GH15G063945 1.5 Ensembl ENCODE dbSUPER 24.8 +126.4 126387 0.9 PKNOX1 FOXA2 SIN3A FEZF1 ZBTB7B ZNF121 ZNF143 FOS DEK ZHX2 DAPK2 HERC1 LOC101928988
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DAPK2 on UCSC Golden Path with GeneCards custom track

Genomic Location for DAPK2 Gene

Chromosome:
15
Start:
63,907,036 bp from pter
End:
64,072,033 bp from pter
Size:
164,998 bases
Orientation:
Minus strand

Genomic View for DAPK2 Gene

Genes around DAPK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DAPK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DAPK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DAPK2 Gene

Proteins for DAPK2 Gene

  • Protein details for DAPK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UIK4-DAPK2_HUMAN
    Recommended name:
    Death-associated protein kinase 2
    Protein Accession:
    Q9UIK4
    Secondary Accessions:
    • E9JGM7
    • O75892
    • Q24JS1

    Protein attributes for DAPK2 Gene

    Size:
    370 amino acids
    Molecular mass:
    42898 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer in its autoinhibited state. Active as monomer (By similarity). Isoform 2 but not isoform 1 can interact with ATF4. Interacts with 14-3-3 proteins YWHAB, YWHAE, YWHAG, YWHAH, YWHAQ, YWHAZ and SFN; the interaction requires DAPK2 phosphorylation at Thr-369 and suppresses DAPK2 kinase activity and DAPK2-induced apoptosis (PubMed:26047703).

    Three dimensional structures from OCA and Proteopedia for DAPK2 Gene

    Alternative splice isoforms for DAPK2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DAPK2 Gene

Selected DME Specific Peptides for DAPK2 Gene

Q9UIK4:
  • GVITYILL
  • EFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILL
  • TSELAKDFIR
  • GDTKQET
  • GEELGSGQFA
  • GTPEFVAPE
  • IAHFDLKPENIMLLD
  • TDVVLILELVSGGELFDFLA

Post-translational modifications for DAPK2 Gene

  • Autophosphorylation at Ser-318 inhibits its catalytic activity. Dephosphorylated at Ser-318 in response to activated Fas and TNF-alpha receptors.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for DAPK2 Gene

Suggested Antigen Peptide Sequences for DAPK2 Gene

Graphical View of Domain Structure for InterPro Entry

Q9UIK4

UniProtKB/Swiss-Prot:

DAPK2_HUMAN :
  • The autoinhibitory domain sterically blocks the substrate peptide-binding site by making both hydrophobic and electrostatic contacts with the kinase core.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
Domain:
  • The autoinhibitory domain sterically blocks the substrate peptide-binding site by making both hydrophobic and electrostatic contacts with the kinase core.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
genes like me logo Genes that share domains with DAPK2: view

Function for DAPK2 Gene

Molecular function for DAPK2 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by Ca(2+)/calmodulin. Regulated by a double locking mechanism, involving autophosphorylation at Ser-318, calmodulin binding, and dimerization. In the inactive state, Ser-318 is phosphorylated, and the kinase is dimeric. Activation involves: dephosphorylation at Ser-318, release-of-autoinhibition mechanism where calmodulin binding induces a conformational change that relieves the steric block of the active site by the autoinhibitory domain, and generation of the monomeric active form of the kinase.
UniProtKB/Swiss-Prot Function:
Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Acts as a mediator of anoikis and a suppressor of beta-catenin-dependent anchorage-independent growth of malignant epithelial cells. May play a role in granulocytic maturation (PubMed:17347302). Regulates granulocytic motility by controlling cell spreading and polarization (PubMed:24163421).
UniProtKB/Swiss-Prot Function:
Isoform 2 is not regulated by calmodulin. It can phosphorylate MYL9. It can induce membrane blebbing and autophagic cell death.
UniProtKB/Swiss-Prot Induction:
Up-regulated during granulocytic maturation (PubMed:17347302, PubMed:24163421).

Enzyme Numbers (IUBMB) for DAPK2 Gene

Gene Ontology (GO) - Molecular Function for DAPK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS 16756490
GO:0005515 protein binding IPI 25416956
GO:0005516 calmodulin binding IEA,IDA 10376525
GO:0005524 ATP binding IDA 10376525
genes like me logo Genes that share ontologies with DAPK2: view
genes like me logo Genes that share phenotypes with DAPK2: view

Animal Models for DAPK2 Gene

MGI Knock Outs for DAPK2:

Animal Model Products

  • Taconic Biosciences Mouse Models for DAPK2

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DAPK2

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DAPK2 Gene

Localization for DAPK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DAPK2 Gene

Cytoplasm. Cytoplasmic vesicle, autophagosome lumen.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DAPK2 gene
Compartment Confidence
golgi apparatus 4
cytosol 3
nucleus 2
lysosome 1

Gene Ontology (GO) - Cellular Components for DAPK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA,IDA 10376525
GO:0005794 Golgi apparatus IDA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0031410 cytoplasmic vesicle IEA --
genes like me logo Genes that share ontologies with DAPK2: view

Pathways & Interactions for DAPK2 Gene

genes like me logo Genes that share pathways with DAPK2: view

Pathways by source for DAPK2 Gene

Gene Ontology (GO) - Biological Process for DAPK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IDA 10376525
GO:0006915 apoptotic process TAS 10629061
GO:0010506 regulation of autophagy TAS 16756490
GO:0016310 phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IBA --
genes like me logo Genes that share ontologies with DAPK2: view

No data available for SIGNOR curated interactions for DAPK2 Gene

Drugs & Compounds for DAPK2 Gene

(6) Drugs for DAPK2 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
DAPK Substrate Peptide Pharma Synthetic peptide substrate for DAPK 0
calcium Nutra 0
Magnesium Nutra 0

(1) Additional Compounds for DAPK2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for DAPK2 Gene

Compound Action Cas Number
DAPK Substrate Peptide Synthetic peptide substrate for DAPK 386769-53-5
genes like me logo Genes that share compounds with DAPK2: view

Transcripts for DAPK2 Gene

Unigene Clusters for DAPK2 Gene

Death-associated protein kinase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DAPK2

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for DAPK2 Gene

No ASD Table

Relevant External Links for DAPK2 Gene

GeneLoc Exon Structure for
DAPK2
ECgene alternative splicing isoforms for
DAPK2

Expression for DAPK2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DAPK2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for DAPK2 Gene

This gene is overexpressed in Whole Blood (x6.7), Heart - Atrial Appendage (x5.2), Muscle - Skeletal (x4.9), and Thyroid (x4.7).

Protein differential expression in normal tissues from HIPED for DAPK2 Gene

This gene is overexpressed in Heart (47.3) and Testis (21.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DAPK2 Gene



Protein tissue co-expression partners for DAPK2 Gene

NURSA nuclear receptor signaling pathways regulating expression of DAPK2 Gene:

DAPK2

SOURCE GeneReport for Unigene cluster for DAPK2 Gene:

Hs.237886

mRNA Expression by UniProt/SwissProt for DAPK2 Gene:

Q9UIK4-DAPK2_HUMAN
Tissue specificity: Expressed in neutrophils and eosinophils (PubMed:24163421). Isoform 2 is expressed in embryonic stem cells (at protein level). Isoform 1 is ubiquitously expressed in all tissue types examined with high levels in heart, lung and skeletal muscle.
genes like me logo Genes that share expression patterns with DAPK2: view

Primer Products

No data available for Evidence on tissue expression from TISSUES and Phenotype-based relationships between genes and organs from Gene ORGANizer for DAPK2 Gene

Orthologs for DAPK2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for DAPK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DAPK2 35
  • 100 (a)
OneToOne
cow
(Bos Taurus)
Mammalia DAPK2 34 35
  • 93.24 (n)
mouse
(Mus musculus)
Mammalia Dapk2 34 16 35
  • 91.8 (n)
dog
(Canis familiaris)
Mammalia DAPK2 35
  • 63 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia DAPK2 35
  • 60 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia DAPK2 35
  • 49 (a)
OneToOne
chicken
(Gallus gallus)
Aves DAPK2 35
  • 54 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 57 (a)
ManyToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia dapk2 34
  • 73.61 (n)
zebrafish
(Danio rerio)
Actinopterygii im:7162965 34
  • 72.58 (n)
DAPK2 (1 of 2) 35
  • 65 (a)
OneToMany
dapk2 35
  • 49 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta bt 35
  • 2 (a)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea dapk-1 35
  • 11 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons PEPKR2 34
  • 47.66 (n)
rice
(Oryza sativa)
Liliopsida Os09g0466900 34
  • 47.34 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 42 (a)
OneToMany
Species where no ortholog for DAPK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rat (Rattus norvegicus)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DAPK2 Gene

ENSEMBL:
Gene Tree for DAPK2 (if available)
TreeFam:
Gene Tree for DAPK2 (if available)

Paralogs for DAPK2 Gene

Paralogs for DAPK2 Gene

genes like me logo Genes that share paralogs with DAPK2: view

Variants for DAPK2 Gene

Sequence variations from dbSNP and Humsavar for DAPK2 Gene

SNP ID Clin Chr 15 pos Sequence Context AA Info Type
rs1000107348 -- 63,935,552(+) GTCTT(C/T)CCTGA intron-variant, nc-transcript-variant
rs1000145543 -- 63,918,191(+) TGCTG(C/G/T)GTGAT intron-variant, reference, missense
rs1000151449 -- 63,926,045(+) TTTGC(C/T)AGTGT reference, synonymous-codon
rs1000159768 -- 63,957,927(+) GAATC(A/G)CCACA intron-variant
rs1000168350 -- 64,032,856(+) TGAGG(C/T)GGGTG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for DAPK2 Gene

Variant ID Type Subtype PubMed ID
esv1414761 CNV insertion 17803354
esv3636720 CNV loss 21293372
esv3636721 CNV gain 21293372
esv3636725 OTHER inversion 21293372
esv3636727 CNV loss 21293372
nsv1134458 CNV deletion 24896259
nsv1567 CNV deletion 18451855
nsv1568 CNV insertion 18451855
nsv1569 CNV deletion 18451855
nsv475825 CNV novel sequence insertion 20440878

Variation tolerance for DAPK2 Gene

Residual Variation Intolerance Score: 72.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 12.68; 94.61% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DAPK2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
DAPK2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DAPK2 Gene

Disorders for DAPK2 Gene

Relevant External Links for DAPK2

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DAPK2

No disorders were found for DAPK2 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for DAPK2 Gene

Publications for DAPK2 Gene

  1. DAP kinase and DRP-1 mediate membrane blebbing and the formation of autophagic vesicles during programmed cell death. (PMID: 11980920) Inbal B. … Kimchi A. (J. Cell Biol. 2002) 3 4 22 64
  2. Autophosphorylation restrains the apoptotic activity of DRP-1 kinase by controlling dimerization and calmodulin binding. (PMID: 11230133) Shani G. … Kimchi A. (EMBO J. 2001) 3 4 22 64
  3. Death-associated protein kinase-related protein 1, a novel serine/threonine kinase involved in apoptosis. (PMID: 10629061) Inbal B. … Kimchi A. (Mol. Cell. Biol. 2000) 3 4 22 64
  4. Death-associated protein kinase 2 is a new calcium/calmodulin- dependent protein kinase that signals apoptosis through its catalytic activity. (PMID: 10376525) Kawai T. … Akira S. (Oncogene 1999) 2 3 4 64
  5. Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins. (PMID: 26047703) Yuasa K. … Tsuji A. (Biochem. Biophys. Res. Commun. 2015) 3 4 64

Products for DAPK2 Gene

Sources for DAPK2 Gene

Content
Loading form....