Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FNTB Gene

Aliases for FNTB Gene

  • Farnesyltransferase, CAAX Box, Beta 2 3 5
  • Ras Proteins Prenyltransferase Subunit Beta 3 4
  • CAAX Farnesyltransferase Subunit Beta 3 4
  • EC 2.5.1.58 4 56
  • FTase-Beta 3 4
  • Protein Farnesyltransferase Subunit Beta 3
  • FPTB 3

External Ids for FNTB Gene

Previous GeneCards Identifiers for FNTB Gene

  • GC14P062781
  • GC14P059247
  • GC14P063443
  • GC14P064523
  • GC14P065381
  • GC14P065454

Summaries for FNTB Gene

CIViC summary for FNTB Gene

GeneCards Summary for FNTB Gene

FNTB (Farnesyltransferase, CAAX Box, Beta) is a Protein Coding gene. Among its related pathways are G-protein signaling_RhoB regulation pathway and Phototransduction. Gene Ontology (GO) annotations related to this gene include drug binding and farnesyltranstransferase activity. An important paralog of this gene is CHURC1-FNTB.

UniProtKB/Swiss-Prot for FNTB Gene

  • Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Gene Wiki entry for FNTB Gene

Additional gene information for FNTB Gene

No data available for Entrez Gene Summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FNTB Gene

Genomics for FNTB Gene

GeneHancer (GH) Regulatory Elements for FNTB Gene

Promoters and enhancers for FNTB Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH14I064986 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 550.8 +0.5 511 2 HDGF PKNOX1 FOXA2 CLOCK MLX ARNT ZFP64 ARID4B SIN3A DMAP1 FNTB GC14P064987 CHURC1 SPTB ENSG00000272158 CHURC1-FNTB
GH14I065042 Enhancer 1.3 Ensembl ENCODE dbSUPER 14.8 +57.1 57140 3 PKNOX1 ATF1 ARNT IRF4 TCF12 ZNF766 GATA2 ATF7 RUNX3 NCOA1 MIR4706 FNTB CHURC1-FNTB CHURC1 PIR35799 MAX
GH14I065047 Enhancer 0.9 Ensembl ENCODE dbSUPER 14.8 +61.3 61330 1.9 OSR2 PRDM6 MZF1 FEZF1 KDM1A ZNF843 FNTB CHURC1-FNTB MIR4706 PIR44037 MAX
GH14I065019 Enhancer 0.9 Ensembl ENCODE 14.7 +33.4 33381 0.6 SOX13 CTCF TFAP4 FOXA2 SAP130 ARID4B RAD21 ZNF766 SMC3 ZNF143 FNTB CHURC1-FNTB GPX2 PIR35799 MIR4706 MAX
GH14I065035 Enhancer 0.7 ENCODE 15.3 +48.5 48518 0.2 RXRA NFIB MAX REST RAD21 FOXA1 NR2F2 GABPA YY1 E2F1 FNTB CHURC1-FNTB MIR4706 PIR35799 MAX
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around FNTB on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the FNTB gene promoter:

Genomic Locations for FNTB Gene

Genomic Locations for FNTB Gene
chr14:64,986,720-65,062,652
(GRCh38/hg38)
Size:
75,933 bases
Orientation:
Plus strand
chr14:65,381,203-65,529,370
(GRCh37/hg19)

Genomic View for FNTB Gene

Genes around FNTB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FNTB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FNTB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FNTB Gene

Proteins for FNTB Gene

  • Protein details for FNTB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P49356-FNTB_HUMAN
    Recommended name:
    Protein farnesyltransferase subunit beta
    Protein Accession:
    P49356
    Secondary Accessions:
    • B2RDX6
    • B4E1A0

    Protein attributes for FNTB Gene

    Size:
    437 amino acids
    Molecular mass:
    48774 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Heterodimer of FNTA and FNTB.

    Three dimensional structures from OCA and Proteopedia for FNTB Gene

    Alternative splice isoforms for FNTB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FNTB Gene

Selected DME Specific Peptides for FNTB Gene

P49356:
  • RERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRL
  • YHTCYCL
  • NKLVDGCY
  • EAHGGYT
  • CPPSSSP
  • FLQKPVPGFEE
  • WMFHQQALQEYILMCCQCP

Post-translational modifications for FNTB Gene

Other Protein References for FNTB Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for FNTB Gene

Gene Families for FNTB Gene

Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for FNTB Gene

Graphical View of Domain Structure for InterPro Entry

P49356

UniProtKB/Swiss-Prot:

FNTB_HUMAN :
  • Belongs to the protein prenyltransferase subunit beta family.
Family:
  • Belongs to the protein prenyltransferase subunit beta family.
genes like me logo Genes that share domains with FNTB: view

Function for FNTB Gene

Molecular function for FNTB Gene

GENATLAS Biochemistry:
CAAX farnesyltransferase,beta subunit,promoting the prenylation of Ras,first step of a series of post translational modification of RAS,required for its association with the inner surface of the plasma membrane,also involved in maturation of other proteins including Ras family members,the gamma subunit of G proteins and nuclear lamins
UniProtKB/Swiss-Prot CatalyticActivity:
Farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
UniProtKB/Swiss-Prot Function:
Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Enzyme Numbers (IUBMB) for FNTB Gene

Phenotypes From GWAS Catalog for FNTB Gene

Gene Ontology (GO) - Molecular Function for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004659 prenyltransferase activity IEA --
GO:0004660 contributes_to protein farnesyltransferase activity IDA,IEA 19228685
GO:0005515 protein binding IPI 11687658
GO:0008270 zinc ion binding IDA 16893176
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with FNTB: view
genes like me logo Genes that share phenotypes with FNTB: view

Animal Models for FNTB Gene

MGI Knock Outs for FNTB:

Animal Model Products

CRISPR Products

miRNA for FNTB Gene

miRTarBase miRNAs that target FNTB

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for FNTB

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FNTB Gene

Localization for FNTB Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FNTB gene
Compartment Confidence
cytoskeleton 4
cytosol 4

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005829 cytosol TAS --
GO:0005875 microtubule associated complex IDA 19228685
GO:0005965 protein farnesyltransferase complex IDA 16893176
genes like me logo Genes that share ontologies with FNTB: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for FNTB Gene

Pathways & Interactions for FNTB Gene

genes like me logo Genes that share pathways with FNTB: view

Gene Ontology (GO) - Biological Process for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018343 protein farnesylation IDA 16893176
GO:0022400 regulation of rhodopsin mediated signaling pathway TAS --
GO:0042127 regulation of cell proliferation IEA --
genes like me logo Genes that share ontologies with FNTB: view

No data available for SIGNOR curated interactions for FNTB Gene

Drugs & Compounds for FNTB Gene

(18) Drugs for FNTB Gene - From: DrugBank, PharmGKB, ApexBio, and DGIdb

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carboplatin Approved Pharma Antitumor agent that forms platinum-DNA adducts., Platinum 2141
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 3027
(11S)-8-CHLORO-11-[1-(METHYLSULFONYL)PIPERIDIN-4-YL]-6-PIPERAZIN-1-YL-11H-BENZO[5,6]CYCLOHEPTA[1,2-B]PYRIDINE Experimental Pharma Target 0
(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRIAZA-CYCLOOCTADECOSINE-9-CARBONITRILE Experimental Pharma Target 0
(20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIAZACYCLONOADECOSINE-9-CARBONITRILE Experimental Pharma Target 0

(2) Additional Compounds for FNTB Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Farnesyl pyrophosphate
  • (2E,6E)-Farnesyl diphosphate
  • (2E,6E)-Farnesyl pyrophosphate
  • (all-E)-Farnesyl diphosphate
  • (E,E)-Farnesyl diphosphate
  • (E,E)-Farnesyl pyrophosphate
13058-04-3
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8

(4) ApexBio Compounds for FNTB Gene

Compound Action Cas Number
FTI 277 HCl FTase inhibitor 180977-34-8
LB42708 Selective FTase inhibitor 226929-39-1
Lonafarnib Ftase inhibitor,potent and selective 193275-84-2
Tipifarnib (Zarnestra) Farnesyltransferase inhibitor,potent and specific 192185-72-1
genes like me logo Genes that share compounds with FNTB: view

Drug Products

Transcripts for FNTB Gene

Unigene Clusters for FNTB Gene

Farnesyltransferase, CAAX box, beta:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for FNTB

Alternative Splicing Database (ASD) splice patterns (SP) for FNTB Gene

No ASD Table

Relevant External Links for FNTB Gene

GeneLoc Exon Structure for
FNTB
ECgene alternative splicing isoforms for
FNTB

Expression for FNTB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for FNTB Gene

mRNA differential expression in normal tissues according to GTEx for FNTB Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FNTB Gene



Protein tissue co-expression partners for FNTB Gene

NURSA nuclear receptor signaling pathways regulating expression of FNTB Gene:

FNTB

SOURCE GeneReport for Unigene cluster for FNTB Gene:

Hs.325531

Evidence on tissue expression from TISSUES for FNTB Gene

  • Eye(4)
  • Kidney(4)
genes like me logo Genes that share expression patterns with FNTB: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for FNTB Gene

Orthologs for FNTB Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for FNTB Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FNTB 34
  • 100 (a)
OneToOne
dog
(Canis familiaris)
Mammalia FNTB 33 34
  • 93.04 (n)
cow
(Bos Taurus)
Mammalia FNTB 33
  • 92.07 (n)
mouse
(Mus musculus)
Mammalia Fntb 33 16 34
  • 90.16 (n)
rat
(Rattus norvegicus)
Mammalia Fntb 33
  • 89.63 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 34
  • 86 (a)
OneToMany
platypus
(Ornithorhynchus anatinus)
Mammalia -- 34
  • 69 (a)
OneToMany
chicken
(Gallus gallus)
Aves -- 34
  • 84 (a)
OneToMany
FNTB 33
  • 76.25 (n)
lizard
(Anolis carolinensis)
Reptilia -- 34
  • 80 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia fntb 33
  • 69.58 (n)
zebrafish
(Danio rerio)
Actinopterygii fntb 33 34
  • 68.92 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001729 33
  • 57.33 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG17565 35 33 34
  • 57.27 (n)
worm
(Caenorhabditis elegans)
Secernentea fntb-1 33 34
  • 50.72 (n)
F23B12.6 35
  • 46 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RAM1 34 36
  • 36 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons ERA1 33
  • 54.25 (n)
rice
(Oryza sativa)
Liliopsida Os01g0737800 33
  • 56.13 (n)
Os.20991 33
wheat
(Triticum aestivum)
Liliopsida Ta.7380 33
corn
(Zea mays)
Liliopsida Zm.14070 33
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 54 (a)
OneToMany
Species where no ortholog for FNTB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for FNTB Gene

ENSEMBL:
Gene Tree for FNTB (if available)
TreeFam:
Gene Tree for FNTB (if available)

Paralogs for FNTB Gene

Paralogs for FNTB Gene

(3) SIMAP similar genes for FNTB Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with FNTB: view

Variants for FNTB Gene

Sequence variations from dbSNP and Humsavar for FNTB Gene

SNP ID Clin Chr 14 pos Variation AA Info Type
rs1000004753 -- 64,997,092(+) C/T intron_variant
rs1000009374 -- 65,039,915(+) G/A intron_variant
rs1000029483 -- 65,011,742(+) A/T intron_variant
rs1000089134 -- 65,059,550(+) TTGTTTT/TT intron_variant
rs1000120893 -- 65,061,045(+) T/C intron_variant

Structural Variations from Database of Genomic Variants (DGV) for FNTB Gene

Variant ID Type Subtype PubMed ID
esv2506970 CNV deletion 19546169
esv2665422 CNV deletion 23128226
esv2748779 CNV deletion 23290073
esv2748787 CNV deletion 23290073
esv3551663 CNV deletion 23714750
nsv1070225 CNV deletion 25765185
nsv1108903 CNV deletion 24896259
nsv832816 CNV gain 17160897

Variation tolerance for FNTB Gene

Residual Variation Intolerance Score: 28.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.35; 7.84% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for FNTB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FNTB

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FNTB Gene

Disorders for FNTB Gene

Additional Disease Information for FNTB

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for FNTB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FNTB Gene

Publications for FNTB Gene

  1. cDNA cloning of the two subunits of human CAAX farnesyltransferase and chromosomal mapping of FNTA and FNTB loci and related sequences. (PMID: 8276393) Andres DA … Francke U (Genomics 1993) 2 3 4 58
  2. Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study. (PMID: 19841875) Fontaine-Bisson B … Morange PE (Journal of molecular medicine (Berlin, Germany) 2010) 3 44 58
  3. Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium. (PMID: 19862010) Ganesh SK … Lin JP (Nature genetics 2009) 3 44 58
  4. Conversion of protein farnesyltransferase to a geranylgeranyltransferase. (PMID: 16893176) Terry KL … Beese LS (Biochemistry 2006) 3 4 58
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 58

Products for FNTB Gene

  • Addgene plasmids for FNTB

Sources for FNTB Gene

Content
Loading form....