Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAST1 Gene

Aliases for MAST1 Gene

  • Microtubule Associated Serine/Threonine Kinase 1 2 3 5
  • Syntrophin-Associated Serine/Threonine-Protein Kinase 3 4
  • EC 2.7.11.1 4 58
  • SAST 3 4
  • Microtubule-Associated Serine/Threonine-Protein Kinase 1 3
  • Syntrophin Associated Serine/Threonine Kinase 3
  • EC 2.7.11 58
  • KIAA0973 4

External Ids for MAST1 Gene

Previous GeneCards Identifiers for MAST1 Gene

  • GC19U900423
  • GC19P012811
  • GC19P012949
  • GC19P012520

Summaries for MAST1 Gene

Entrez Gene Summary for MAST1 Gene

  • This gene is a member of the microtubule-associated serine/threonine kinase (MAST) family. The protein encoded by this gene has an N-terminal serine/threonine kinase domain followed by a postsynaptic density protein-95/discs large/zona occludens-1 (PDZ) domain. In mouse and rat, the orthologous protein associates with the cytoskeleton and can bind both beta-2-syntrophin and neuronal nitric oxide synthase (nNOS) through its PDZ domain. In mouse and rat, this protein also co-localizes with dystrophin- and utrophin-associated protein complexes (DAPC/UAPC) in the vascular endothelium of the central nervous system. [provided by RefSeq, May 2017]

GeneCards Summary for MAST1 Gene

MAST1 (Microtubule Associated Serine/Threonine Kinase 1) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAST2.

UniProtKB/Swiss-Prot for MAST1 Gene

  • Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins (By similarity).

Gene Wiki entry for MAST1 Gene

Additional gene information for MAST1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAST1 Gene

Genomics for MAST1 Gene

Regulatory Elements for MAST1 Gene

Enhancers for MAST1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH19H013050 2.4 VISTA FANTOM5 Ensembl ENCODE dbSUPER 10.9 +222.3 222344 12 FOXA2 MLX ZFP64 ARID4B FEZF1 DMAP1 ZNF2 ZNF766 ZNF143 FOS LYL1 NACC1 TRMT1 MAST1 STX10 CALR GCDH ENSG00000267610 PIR45233
GH19H013000 1.4 FANTOM5 Ensembl ENCODE dbSUPER 15.5 +168.0 168007 3 BCOR HIC1 ZNF366 ZMYM3 KDM1A ZFX MAST1 GCDH MAN2B1 RPL12P42 STX10 TNPO2 ZNF490 NFIX GC19M012993 ENSG00000267417
GH19H012757 1.4 Ensembl ENCODE dbSUPER 12.3 -76.0 -76014 1 HDAC1 FOXA2 RB1 ARID4B ZNF76 SIN3A ZNF2 RAD21 ZNF366 ZNF143 JUNB HOOK2 ASNA1 TRIR TNPO2 MAST1 RNASEH2A RTBDN WDR83OS WDR83
GH19H012765 1.2 ENCODE dbSUPER 11.8 -67.8 -67808 1 MLX ARID4B SIN3A DMAP1 ZNF2 ZNF121 SLC30A9 ZNF143 ZNF207 DEK PRDX2 RNASEH2A MAST1 DNASE2 GC19M012776 GC19M012762 BEST2
GH19H012805 1.1 ENCODE 12.8 -27.2 -27179 1 HDGF PKNOX1 ARNT ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ZNF20 ZNF136 RNASEH2A ZNF490 ZNF763 ZNF791 MAST1 RTBDN BEST2 ZNF44
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MAST1 on UCSC Golden Path with GeneCards custom track

Promoters for MAST1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000107316 -34 201 HDAC1 NCOA6 MAZ RB1 YY2 NFXL1 ZNF398 ZIC2 E2F1 SKIL

Genomic Location for MAST1 Gene

Chromosome:
19
Start:
12,833,934 bp from pter
End:
12,874,953 bp from pter
Size:
41,020 bases
Orientation:
Plus strand

Genomic View for MAST1 Gene

Genes around MAST1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAST1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAST1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAST1 Gene

Proteins for MAST1 Gene

  • Protein details for MAST1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9Y2H9-MAST1_HUMAN
    Recommended name:
    Microtubule-associated serine/threonine-protein kinase 1
    Protein Accession:
    Q9Y2H9
    Secondary Accessions:
    • O00114
    • Q8N6X0

    Protein attributes for MAST1 Gene

    Size:
    1570 amino acids
    Molecular mass:
    170677 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Part of a low affinity complex that associates with, but is distinct from, the postsynaptic density. Interacts with SNTB2 (By similarity).
    SequenceCaution:
    • Sequence=AAB51171.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAH27985.2; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA76817.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for MAST1 Gene

neXtProt entry for MAST1 Gene

Selected DME Specific Peptides for MAST1 Gene

Q9Y2H9:
  • MMNHVYKERFPKATAQMEE
  • SYKAKMARR
  • PRYIIRQLGL
  • MFCSFET
  • AETVLALEYLH
  • LYEFLVGCVPFFGDTPEELFGQV
  • RPRSRSL
  • CSFETRRHLCMVMEYVEGGDCATL
  • CGTPEYIAPE
  • HIRPSTLHGL
  • ELARDCL
  • KRSSLFRKITKQ
  • DNEIVMMNHVY
  • DELHFLSKHF
  • KSAGNIPLSPLA
  • RSLSPGR
  • GKPVDWWA
  • RPARLLECLEF
  • PRSPLLKRVQS
  • EVVELILKSGNKVA
  • GHIKLTDFGLSK
  • IKLTDFG
  • KVIKSASATALS
  • WPEGDEALP
  • LLHTSRSLSSLNRSLSS
  • EVKQHSFF
  • GIVHRDLKPDN
  • KVYSSME
  • LHQLPYQPT
  • FVERDILTFAENPFVV
  • LLEAAEGHAKEG
  • RFSKVYSS
  • SPLASPMSP
  • RHLCMVMEYVEGGDCATLLKNIGALPV
  • LTDFGLSK
  • KLTDFGL
  • DGRRWSLASLPSSGYGTNTPSSTVSSSCSSQE
  • SYRSTPD
  • TIKLISNGAYGAVYLVRHRDTRQRFA
  • LSFIHHQ
  • TTTPFENTSI
  • LPRPHSPL
  • GHIKLTD
  • LDWTGLLRQKAEFIP
  • NLEKLLQDA
  • VHRDLKP
  • IVHRDLK

Post-translational modifications for MAST1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for MAST1 Gene

Domains & Families for MAST1 Gene

Gene Families for MAST1 Gene

Suggested Antigen Peptide Sequences for MAST1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9Y2H9

UniProtKB/Swiss-Prot:

MAST1_HUMAN :
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
genes like me logo Genes that share domains with MAST1: view

Function for MAST1 Gene

Molecular function for MAST1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins (By similarity).

Enzyme Numbers (IUBMB) for MAST1 Gene

Phenotypes From GWAS Catalog for MAST1 Gene

Gene Ontology (GO) - Molecular Function for MAST1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding ISS,IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity ISS,IEA --
GO:0005515 protein binding IPI 20029029
GO:0005524 ATP binding ISS,IEA --
genes like me logo Genes that share ontologies with MAST1: view
genes like me logo Genes that share phenotypes with MAST1: view

Animal Model Products

  • Taconic Biosciences Mouse Models for MAST1

CRISPR Products

miRNA for MAST1 Gene

miRTarBase miRNAs that target MAST1

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MAST1
  • Applied Biological Materials Clones for MAST1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MAST1 Gene

Localization for MAST1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAST1 Gene

Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Note=Colocalizes with syntrophins at the cell membrane. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAST1 gene
Compartment Confidence
plasma membrane 4
cytoskeleton 3
cytosol 3
nucleus 2
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for MAST1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IBA,IEA --
GO:0005737 cytoplasm IEA --
GO:0005856 cytoskeleton IEA --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with MAST1: view

Pathways & Interactions for MAST1 Gene

SuperPathways for MAST1 Gene

No Data Available

SIGNOR curated interactions for MAST1 Gene

Inactivates:

Gene Ontology (GO) - Biological Process for MAST1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation ISS,IEA --
GO:0007010 cytoskeleton organization IEA,ISS --
GO:0016310 phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IBA --
GO:0035556 intracellular signal transduction ISS,IEA --
genes like me logo Genes that share ontologies with MAST1: view

No data available for Pathways by source for MAST1 Gene

Drugs & Compounds for MAST1 Gene

(2) Drugs for MAST1 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
ATP Nutra Agonist 0
Magnesium Nutra 0

(1) Additional Compounds for MAST1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with MAST1: view

Transcripts for MAST1 Gene

Unigene Clusters for MAST1 Gene

Microtubule associated serine/threonine kinase 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MAST1
  • Applied Biological Materials Clones for MAST1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for MAST1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b · 7c ^ 8 ^ 9a · 9b ^ 10 ^ 11 ^ 12a · 12b · 12c ^ 13 ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^
SP1: - - -
SP2:
SP3:
SP4: -
SP5: -
SP6: -
SP7:
SP8:

ExUns: 21a · 21b ^ 22 ^ 23 ^ 24 ^ 25a · 25b ^ 26a · 26b
SP1: - -
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:

Relevant External Links for MAST1 Gene

GeneLoc Exon Structure for
MAST1
ECgene alternative splicing isoforms for
MAST1

Expression for MAST1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAST1 Gene

mRNA differential expression in normal tissues according to GTEx for MAST1 Gene

This gene is overexpressed in Brain - Cerebellum (x9.6), Brain - Cerebellar Hemisphere (x9.0), Brain - Cortex (x6.4), and Brain - Frontal Cortex (BA9) (x4.5).

Protein differential expression in normal tissues from HIPED for MAST1 Gene

This gene is overexpressed in Serum (47.6), Fetal Brain (11.1), and Frontal cortex (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAST1 Gene



Protein tissue co-expression partners for MAST1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of MAST1 Gene:

MAST1

SOURCE GeneReport for Unigene cluster for MAST1 Gene:

Hs.227489

Evidence on tissue expression from TISSUES for MAST1 Gene

  • Nervous system(4.6)
genes like me logo Genes that share expression patterns with MAST1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAST1 Gene

Orthologs for MAST1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MAST1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAST1 33 34
  • 98.68 (n)
dog
(Canis familiaris)
Mammalia -- 34
  • 95 (a)
OneToMany
-- 34
  • 94 (a)
OneToMany
MAST1 33
  • 88.81 (n)
cow
(Bos Taurus)
Mammalia MAST1 33 34
  • 89.32 (n)
oppossum
(Monodelphis domestica)
Mammalia MAST1 34
  • 88 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia MAST1 34
  • 88 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Mast1 33 16 34
  • 85.99 (n)
rat
(Rattus norvegicus)
Mammalia MAST1 33
  • 85.57 (n)
lizard
(Anolis carolinensis)
Reptilia MAST1 34
  • 77 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mast1 33
  • 67.75 (n)
zebrafish
(Danio rerio)
Actinopterygii mast1a 33 34
  • 71 (n)
mast1b 34
  • 65 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta CG6498 34
  • 30 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea kin-4 34
  • 30 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KIN82 34
  • 27 (a)
ManyToMany
FPK1 34
  • 24 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 43 (a)
OneToMany
Species where no ortholog for MAST1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MAST1 Gene

ENSEMBL:
Gene Tree for MAST1 (if available)
TreeFam:
Gene Tree for MAST1 (if available)

Paralogs for MAST1 Gene

Paralogs for MAST1 Gene

genes like me logo Genes that share paralogs with MAST1: view

Variants for MAST1 Gene

Sequence variations from dbSNP and Humsavar for MAST1 Gene

SNP ID Clin Chr 19 pos Sequence Context AA Info Type
VAR_040768 A metastatic melanoma sample
VAR_040769 An ovarian serous carcinoma sample
rs878853165 Likely pathogenic 12,843,558(+) GGCCT(C/T)GCTCC reference, missense
rs1000101137 -- 12,855,013(+) ATCAC(G/T)TGAGG intron-variant
rs1000101908 -- 12,873,257(+) GCCGT(G/T)AAATG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for MAST1 Gene

Variant ID Type Subtype PubMed ID
esv2663622 CNV deletion 23128226
esv3643714 CNV loss 21293372
nsv1153883 CNV duplication 26484159
nsv2420 CNV insertion 18451855
nsv953977 CNV deletion 24416366

Variation tolerance for MAST1 Gene

Residual Variation Intolerance Score: 1.29% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.34; 26.62% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MAST1 Gene

Human Gene Mutation Database (HGMD)
MAST1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAST1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAST1 Gene

Disorders for MAST1 Gene

Relevant External Links for MAST1

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MAST1

No disorders were found for MAST1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MAST1 Gene

Publications for MAST1 Gene

  1. The DNA sequence and biology of human chromosome 19. (PMID: 15057824) Grimwood J … Lucas SM (Nature 2004) 3 4 60
  2. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 60
  3. Sast124, a novel splice variant of syntrophin-associated serine/threonine kinase (SAST), is specifically localized in the restricted brain regions. (PMID: 12614677) Yano R … Hashikawa T (Neuroscience 2003) 3 22 60
  4. Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10231032) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 3 4 60
  5. Interactions between beta 2-syntrophin and a family of microtubule-associated serine/threonine kinases. (PMID: 10404183) Lumeng C … Chamberlain JS (Nature neuroscience 1999) 3 22 60

Products for MAST1 Gene

  • Addgene plasmids for MAST1

Sources for MAST1 Gene

Content
Loading form....