Aliases for ACSL1 Gene
Aliases for ACSL1 Gene
- Acyl-CoA Synthetase Long Chain Family Member 1 2 3 5
- Fatty-Acid-Coenzyme A Ligase, Long-Chain 2 2 3
- Long-Chain Fatty-Acid-Coenzyme A Ligase 1 2 3
- Long-Chain Fatty Acid-CoA Ligase 2 3 4
- Long-Chain Acyl-CoA Synthetase 1 3 4
- Long-Chain Acyl-CoA Synthetase 2 3 4
- Lignoceroyl-CoA Synthase 2 3
- Palmitoyl-CoA Ligase 1 3 4
- Palmitoyl-CoA Ligase 2 3 4
- Acyl-CoA Synthetase 1 3 4
- EC 6.2.1.3 4 56
- LACS 1 3 4
External Ids for ACSL1 Gene
- HGNC: 3569
- Entrez Gene: 2180
- Ensembl: ENSG00000151726
- OMIM: 152425
- UniProtKB: P33121
Previous HGNC Symbols for ACSL1 Gene
- FACL2
Previous GeneCards Identifiers for ACSL1 Gene
- GC04M186373
- GC04M186051
- GC04M185914
- GC04M185676
- GC04M181430
Summaries for ACSL1 Gene
-
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
GeneCards Summary for ACSL1 Gene
ACSL1 (Acyl-CoA Synthetase Long Chain Family Member 1) is a Protein Coding gene. Diseases associated with ACSL1 include Peach Allergy and Fruit Allergy. Among its related pathways are Fatty Acyl-CoA Biosynthesis and fatty acid beta-oxidation (peroxisome). Gene Ontology (GO) annotations related to this gene include long-chain fatty acid-CoA ligase activity. An important paralog of this gene is ACSL6.
UniProtKB/Swiss-Prot for ACSL1 Gene
-
Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate.
Additional gene information for ACSL1 Gene
- Monarch Initiative
- Search for ACSL1 at DataMed
- Search for ACSL1 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ACSL1 Gene
Genomics for ACSL1 Gene
GeneHancer (GH) Regulatory Elements for ACSL1 Gene
- Top Transcription factor binding sites by QIAGEN in the ACSL1 gene promoter:
Regulatory Element Products
Genomic Locations for ACSL1 Gene
- chr4:184,755,595-184,826,818
- (GRCh38/hg38)
- Size:
- 71,224 bases
- Orientation:
- Minus strand
- chr4:185,676,749-185,747,972
- (GRCh37/hg19)
Genomic View for ACSL1 Gene
- Cytogenetic band:
-
- 4q35.1 by Ensembl
- 4q35.1 by Entrez Gene
- 4q35.1 by HGNC


RefSeq DNA sequence for ACSL1 Gene
Proteins for ACSL1 Gene
-
Protein details for ACSL1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P33121-ACSL1_HUMAN
- Recommended name:
- Long-chain-fatty-acid--CoA ligase 1
- Protein Accession:
- P33121
- B7Z452
- D3DP57
- P41215
- Q8N8V7
- Q8TA99
Protein attributes for ACSL1 Gene
- Size:
- 698 amino acids
- Molecular mass:
- 77943 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
- No Data Available
- SequenceCaution:
-
- Sequence=BAC04704.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Protein Expression for ACSL1 Gene
Selected DME Specific Peptides for ACSL1 Gene
- P33121:
-
- VPLYDTLG
- GFFQGDIRLL
- FAQNRPEW
- PGDWTAGHVG
- CFTSGTTGNPKGAM
- AITYIVNKAELS
- RQYVRTLPTNTLMGFGAFAALTTFWYATRPK
- DGWLHTGD
- LKIIDRKK
- LPLAHMFE
- YGQTECT
- DGWLHTGDIGKWLP
Post-translational modifications for ACSL1 Gene
Other Protein References for ACSL1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for ACSL1 (ACSL1)
- Novus Biologicals Antibodies for ACSL1
-
Abcam antibodies for ACSL1
- Invitrogen Antibodies for ACSL1
- GeneTex ACSL1 antibody for ACSL1
-
Custom Antibody ServicesProSci Antibodies for ACSL1
-
Santa Cruz Biotechnology (SCBT) Antibodies for ACSL1
Protein Products
-
OriGene Purified Proteins for ACSL1
- Search Origene for MassSpec and Protein Over-expression Lysates for ACSL1
- Origene Custom Protein Services for ACSL1
- Novus Biologicals proteins for ACSL1
- Search GeneTex for Proteins for ACSL1
-
Abcam proteins for ACSL1
Assay Products
Domains & Families for ACSL1 Gene
Gene Families for ACSL1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for ACSL1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for ACSL1 Gene
- GenScript: Design optimal peptide antigens:
-
- Palmitoyl-CoA ligase 2 (ACSL1_HUMAN)
- cDNA FLJ53511, highly similar to Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (B7Z3Z9_HUMAN)
- cDNA FLJ59311, highly similar to Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (B7Z452_HUMAN)
- Acyl-CoA synthetase long-chain family member 1 isoform a (Q108N1_HUMAN)
- Acyl-CoA synthetase long-chain family member 1 isoform c (Q108N2_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P33121- Family:
-
- Belongs to the ATP-dependent AMP-binding enzyme family.
Function for ACSL1 Gene
Molecular function for ACSL1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a long-chain fatty acid + CoA = AMP + diphosphate + an acyl-CoA.
- UniProtKB/Swiss-Prot Function:
- Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate.
Enzyme Numbers (IUBMB) for ACSL1 Gene
Phenotypes From GWAS Catalog for ACSL1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0003824 | catalytic activity | IEA | -- |
GO:0004467 | long-chain fatty acid-CoA ligase activity | TAS | -- |
GO:0005524 | ATP binding | IEA | -- |
GO:0016874 | ligase activity | IEA | -- |
GO:0102391 | decanoate--CoA ligase activity | IEA | -- |
Phenotypes for ACSL1 Gene
- MGI mutant phenotypes for ACSL1:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for ACSL1:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for ACSL1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for ACSL1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ACSL1 gene
- Search ViGene Biosciences for ACSL1
CRISPR Products
-
OriGene CRISPR knockouts for ACSL1
- genomics-online: gRNA clones - Search results for available Acsl1 gene related products
- Applied Biological Materials CRISPR for ACSL1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ACSL1
- GenScript: Design CRISPR guide RNA sequences for ACSL1
miRNA for ACSL1 Gene
- miRTarBase miRNAs that target ACSL1
miRNA Products
- Search ViGene Biosciences for ACSL1
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for ACSL1
- Browse OriGene Inhibitory RNA Products For ACSL1
- genomics-online: shRNA clones - Search results for available Acsl1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ACSL1 gene
Clone Products
- Sino Biological Human cDNA Clone for ACSL1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for ACSL1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ACSL1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for available Acsl1 gene related products
- orf clones - Search results for available Acsl1 gene related products
- Applied Biological Materials Clones for ACSL1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for ACSL1
-
ViGene Biosciences adenoviral particle packaged cDNA for ACSL1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for ACSL1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ACSL1 gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ACSL1 Gene
Localization for ACSL1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ACSL1 Gene
- Mitochondrion outer membrane; Single-pass type III membrane protein. Peroxisome membrane; Single-pass type III membrane protein. Microsome membrane; Single-pass type III membrane protein. Endoplasmic reticulum membrane; Single-pass type III membrane protein.
- Mitochondria (3)
- Nucleus (3)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005739 | mitochondrion | IDA,IEA | 22022213 |
GO:0005741 | mitochondrial outer membrane | TAS | -- |
GO:0005777 | peroxisome | IEA | -- |
GO:0005778 | peroxisomal membrane | IEA | -- |
GO:0005783 | endoplasmic reticulum | IEA | -- |
Pathways & Interactions for ACSL1 Gene
Pathways by source for ACSL1 Gene
1 Cell Signaling Technology pathway for ACSL1 Gene
9 BioSystems pathways for ACSL1 Gene
11 Reactome pathways for ACSL1 Gene
8 KEGG pathways for ACSL1 Gene
Interacting Proteins for ACSL1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0001676 | long-chain fatty acid metabolic process | IDA | 22022213 |
GO:0006629 | lipid metabolic process | IEA | -- |
GO:0006631 | fatty acid metabolic process | IEA | -- |
GO:0006641 | triglyceride metabolic process | IEA | -- |
GO:0007584 | response to nutrient | IEA | -- |
No data available for SIGNOR curated interactions for ACSL1 Gene
Drugs & Compounds for ACSL1 Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Adenosine monophosphate | Approved, Investigational | Nutra | Target, product of | 0 | ||
Palmitic Acid | Approved, Experimental | Pharma | Full agonist, Agonist | 23 | ||
Phosphoric acid | Approved | Pharma | 0 | |||
Magnesium | Approved | Nutra | 0 | |||
Hexanoyl-CoA | Experimental | Pharma | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
(2E)-Decenoyl-CoA |
|
10018-95-8 |
|
|||
(2E)-Dodecenoyl-CoA |
|
1066-12-2 |
|
|||
(2E)-Hexadecenoyl-CoA |
|
4460-95-1 |
|
|||
(2E)-Octenoyl-CoA |
|
10018-94-7 |
|
|||
(2E)-Tetradecenoyl-CoA |
|
38795-33-4 |
|
Transcripts for ACSL1 Gene
mRNA/cDNA for ACSL1 Gene
- (12) REFSEQ mRNAs :
- (10) Additional mRNA sequences :
- (416) Selected AceView cDNA sequences:
- (12) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for ACSL1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for ACSL1
- genomics-online: gRNA clones - Search results for available Acsl1 gene related products
- Applied Biological Materials CRISPR for ACSL1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ACSL1
- GenScript: Design CRISPR guide RNA sequences for ACSL1
miRNA Products
- Search ViGene Biosciences for ACSL1
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for ACSL1
- Browse OriGene Inhibitory RNA Products For ACSL1
- genomics-online: shRNA clones - Search results for available Acsl1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ACSL1 gene
Clone Products
- Sino Biological Human cDNA Clone for ACSL1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for ACSL1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ACSL1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for available Acsl1 gene related products
- orf clones - Search results for available Acsl1 gene related products
- Applied Biological Materials Clones for ACSL1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | · | 2d | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6a | · | 6b | · | 6c | · | 6d | ^ | 7a | · | 7b | ^ | 8 | ^ | 9a | · | 9b | ^ | 10a | · | 10b | · | 10c | ^ | 11a | · | 11b | · | 11c | ^ | 12a | · |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||
SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
SP7: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
SP8: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
SP9: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
SP10: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
SP11: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||
SP12: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
SP13: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
SP14: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP15: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP16: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
SP17: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
SP18: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP19: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP20: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP21: |
ExUns: | 12b | ^ | 13a | · | 13b | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19a | · | 19b | ^ | 20 | ^ | 21 | ^ | 22a | · | 22b | · | 22c | ^ | 23a | · | 23b | · | 23c | ^ | 24 | ^ | 25 | ^ | 26 | ^ | 27a | · | 27b | · | 27c | ^ | 28 | ^ | 29 | ^ |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
SP2: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP8: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP12: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP14: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP15: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP16: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP17: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP18: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP19: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP20: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP21: | - |
ExUns: | 30 | ^ | 31a | · | 31b | · | 31c |
---|---|---|---|---|---|---|---|
SP1: | |||||||
SP2: | |||||||
SP3: | |||||||
SP4: | |||||||
SP5: | |||||||
SP6: | |||||||
SP7: | |||||||
SP8: | |||||||
SP9: | |||||||
SP10: | |||||||
SP11: | |||||||
SP12: | |||||||
SP13: | |||||||
SP14: | |||||||
SP15: | |||||||
SP16: | |||||||
SP17: | |||||||
SP18: | |||||||
SP19: | |||||||
SP20: | |||||||
SP21: |
Expression for ACSL1 Gene
mRNA differential expression in normal tissues according to GTEx for ACSL1 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ACSL1 Gene
NURSA nuclear receptor signaling pathways regulating expression of ACSL1 Gene:
ACSL1SOURCE GeneReport for Unigene cluster for ACSL1 Gene:
Hs.406678mRNA Expression by UniProt/SwissProt for ACSL1 Gene:
P33121-ACSL1_HUMANEvidence on tissue expression from TISSUES for ACSL1 Gene
- Liver(4.8)
- Nervous system(4.6)
- Heart(2.9)
- Muscle(2.9)
- Blood(2.7)
- Kidney(2.6)
- Intestine(2.4)
- Lung(2.4)
- Skin(2.4)
- Spleen(2.1)
- Bone marrow(2)
Primer Products
-
OriGene qPCR primer pairs for ACSL1
-
OriGene qPCR primer pairs and template standards for ACSL1
- genomics-online: primer clones - Search results for available Acsl1 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for ACSL1 Gene
Orthologs for ACSL1 Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | ACSL1 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | ACSL1 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | ACSL1 33 34 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | ACSL1 34 |
|
OneToOne | |
mouse (Mus musculus) |
Mammalia | Acsl1 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Acsl1 33 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | ACSL1 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | ACSL1 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | ACSL1 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | acsl1 33 |
|
||
Str.1693 33 |
|
||||
zebrafish (Danio rerio) |
Actinopterygii | acsl1a 34 |
|
OneToMany | |
acsl1b 34 |
|
OneToMany | |||
fruit fly (Drosophila melanogaster) |
Insecta | CG3961 34 |
|
OneToMany | |
worm (Caenorhabditis elegans) |
Secernentea | acs-13 34 |
|
ManyToMany | |
acs-5 34 |
|
ManyToMany | |||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | FAA2 34 36 |
|
OneToMany | |
thale cress (Arabidopsis thaliana) |
eudicotyledons | LACS7 33 |
|
||
soybean (Glycine max) |
eudicotyledons | Gma.7613 33 |
|
||
wheat (Triticum aestivum) |
Liliopsida | Ta.9051 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
ManyToMany | |
CSA.10659 34 |
|
ManyToMany |
- Species where no ortholog for ACSL1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
Paralogs for ACSL1 Gene
(6) SIMAP similar genes for ACSL1 Gene using alignment to 10 proteins:
Variants for ACSL1 Gene
SNP ID | Clin | Chr 04 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000003701 | -- | 184,780,151(-) | C/T | intron_variant | |
rs1000054049 | -- | 184,816,313(-) | C/G | genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant | |
rs1000062018 | -- | 184,803,556(-) | G/A | intron_variant | |
rs1000133894 | -- | 184,809,648(-) | T/C | genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant | |
rs1000192334 | -- | 184,821,376(-) | G/C | genic_upstream_transcript_variant, intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv1551e212 | CNV | loss | 25503493 |
dgv9419n54 | CNV | gain | 21841781 |
dgv9420n54 | CNV | gain+loss | 21841781 |
esv2662137 | CNV | deletion | 23128226 |
esv28765 | CNV | loss | 19812545 |
esv3376279 | CNV | duplication | 20981092 |
esv3569855 | CNV | loss | 25503493 |
esv3569856 | CNV | loss | 25503493 |
esv3603469 | CNV | gain | 21293372 |
esv3603470 | CNV | gain | 21293372 |
esv3603471 | CNV | loss | 21293372 |
esv3603472 | CNV | gain | 21293372 |
nsv1026074 | CNV | gain | 25217958 |
nsv1073823 | CNV | deletion | 25765185 |
nsv1119017 | CNV | deletion | 24896259 |
nsv596352 | CNV | gain+loss | 21841781 |
nsv596355 | CNV | gain | 21841781 |
nsv596361 | CNV | loss | 21841781 |
nsv822880 | CNV | gain | 20364138 |
nsv830168 | CNV | loss | 17160897 |
nsv949860 | CNV | duplication | 24416366 |
Additional Variant Information for ACSL1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ACSL1 Gene
Disorders for ACSL1 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
peach allergy |
|
|
fruit allergy |
|
|
hodgkin's lymphoma, mixed cellularity |
|
|
body mass index quantitative trait locus 11 |
|
Additional Disease Information for ACSL1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for ACSL1 Gene
Publications for ACSL1 Gene
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 44 58
- Gene-nutrient interactions with dietary fat modulate the association between genetic variation of the ACSL1 gene and metabolic syndrome. (PMID: 20176858) Phillips CM … Roche HM (Journal of lipid research 2010) 3 44 58
- Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations. (PMID: 18660489) Lu Y … Boer JM (Journal of lipid research 2008) 3 44 58
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
Products for ACSL1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ACSL1
- Search Origene for MassSpec and Protein Over-expression Lysates for ACSL1
- Origene Custom Protein Services for ACSL1
- Origene shrna and RNAi products in human, mouse, rat for ACSL1
- Browse OriGene Inhibitory RNA Products For ACSL1
- OriGene qPCR primer pairs and template standards for ACSL1
- OriGene qPCR primer pairs for ACSL1
- OriGene CRISPR knockouts for ACSL1
- OriGene ORF clones in human for ACSL1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ACSL1
- GenScript: Next-day shipping of latest version cDNA ORF clones for ACSL1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for ACSL1
- GenScript Custom Assay Services for ACSL1
- GenScript Custom overexpressing Cell Line Services for ACSL1
- GenScript: Design CRISPR guide RNA sequences for ACSL1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for ACSL1
- Cell Signaling Technology (CST) Antibodies for ACSL1 (ACSL1)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for ACSL1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for ACSL1
- Novus Biologicals proteins for ACSL1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for ACSL1
- Abcam proteins for ACSL1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for ACSL1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for ACSL1
- VectorBuilder custom plasmid, inducible vectors for ACSL1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ACSL1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 67 available Acsl1 Antibodies ranked by validation data
- Compare Top Acsl1 Antibodies
- antibodies-online: Search results for 2 available Acsl1 Elisa Kits ranked by validation data
- Compare Top Acsl1 Elisa Kits
- Recommended
- antibodies-online: Search results for 6 available Acsl1 Proteins ranked by validation data
- Compare Top Acsl1 Proteins
- GeneTex ACSL1 antibody for ACSL1
- Search GeneTex for Proteins for ACSL1
- ViGene Biosciences adenoviral particle packaged cDNA for ACSL1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for ACSL1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for ACSL1 gene
- Search ViGene Biosciences for ACSL1
- Santa Cruz Biotechnology (SCBT) Antibodies for ACSL1
- Search Santa Cruz Biotechnology (SCBT) for ACSL1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ACSL1
- Custom Antibody ServicesProSci Antibodies for ACSL1
- Search for ACSL1 Proteins at ProSci
- Horizon Cell Lines for ACSL1
- genomics-online: cdna clones - Search results for available Acsl1 gene related products
- orf clones - Search results for available Acsl1 gene related products
- genomics-online: gRNA clones - Search results for available Acsl1 gene related products
- genomics-online: primer clones - Search results for available Acsl1 gene related products
- genomics-online: shRNA clones - Search results for available Acsl1 gene related products
Sources for ACSL1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew