Aliases for EPHA3 Gene
Aliases for EPHA3 Gene
External Ids for EPHA3 Gene
- HGNC: 3387
- Entrez Gene: 2042
- Ensembl: ENSG00000044524
- OMIM: 179611
- UniProtKB: P29320
Previous HGNC Symbols for EPHA3 Gene
- ETK
- ETK1
- TYRO4
Previous GeneCards Identifiers for EPHA3 Gene
- GC03P089525
- GC03P092010
- GC03P089036
- GC03P089239
Summaries for EPHA3 Gene
-
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]
GeneCards Summary for EPHA3 Gene
EPHA3 (EPH Receptor A3) is a Protein Coding gene. Diseases associated with EPHA3 include Beriberi and Kummell's Disease. Among its related pathways are Development Slit-Robo signaling and EPH-Ephrin signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA5.
UniProtKB/Swiss-Prot for EPHA3 Gene
-
Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.
-
Eph receptors are the largest family of receptor tyrosine kinases (RTKs) and are divided into two subclasses, EphA and EphB. Originally identified as mediators of axon guidance, Eph receptors are implicated in many processes, particularly cancer development and progression.
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EPHA3 Gene
Genomics for EPHA3 Gene
GeneHancer (GH) Regulatory Elements for EPHA3 Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH03I089107 | Promoter/Enhancer | 1.8 | EPDnew Ensembl ENCODE | 550.8 | 0.0 | -23 | 0.6 | PKNOX1 ARNT INSM2 MZF1 ZNF76 SIN3A ZNF2 IRF4 ZEB1 ZNF335 | EPHA3 GC03M089046 | |
GH03I089108 | Promoter | 0.8 | Ensembl | 550.8 | +0.6 | 576 | 0.2 | ZNF335 MXI1 L3MBTL2 ZNF341 PRDM10 ZNF600 ZBTB17 | EPHA3 GC03P089148 | |
GH03I089303 | Enhancer | 0.2 | FANTOM5 | 9.5 | +196.2 | 196178 | 0.4 | EPHA3 GC03M089148 GC03P089376 | ||
GH03I088689 | Enhancer | 0.2 | ENCODE | 5.1 | -416.8 | -416783 | 2.2 | EPHA3 GC03P088710 GC03P088601 | ||
GH03I089113 | Enhancer | 1 | Ensembl ENCODE | 0.4 | +7.5 | 7524 | 2.7 | PKNOX1 KLF17 SIN3A FEZF1 GLI4 ZNF2 ZNF48 RAD21 ZEB1 ZNF335 | EPHA3 GC03P089148 |
Regulatory Element Products
Genomic Locations for EPHA3 Gene
- chr3:89,107,524-89,482,134
- (GRCh38/hg38)
- Size:
- 374,611 bases
- Orientation:
- Plus strand
- chr3:89,156,674-89,531,284
- (GRCh37/hg19)
Genomic View for EPHA3 Gene
- Cytogenetic band:
-
- 3p11.1 by Ensembl
- 3p11.1 by Entrez Gene
- 3p11.1 by HGNC


RefSeq DNA sequence for EPHA3 Gene
Proteins for EPHA3 Gene
-
Protein details for EPHA3 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P29320-EPHA3_HUMAN
- Recommended name:
- Ephrin type-A receptor 3
- Protein Accession:
- P29320
- Q9H2V3
- Q9H2V4
Protein attributes for EPHA3 Gene
- Size:
- 983 amino acids
- Molecular mass:
- 110131 Da
- Quaternary structure:
-
- Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses. Forms a ternary EFNA5-EPHA3-ADAM10 complex mediating EFNA5 extracellular domain shedding by ADAM10 which regulates the EFNA5-EPHA3 complex internalization and function. Interacts with NCK1 (via SH2 domain); mediates EFNA5-EPHA3 signaling (By similarity). Interacts (phosphorylated) with PTPN1; dephosphorylates EPHA3 and may regulate its trafficking and function. Interacts (phosphorylated) with CRK; mediates EFNA5-EPHA3 signaling through RHOA GTPase activation.
Three dimensional structures from OCA and Proteopedia for EPHA3 Gene
Protein Expression for EPHA3 Gene
Selected DME Specific Peptides for EPHA3 Gene
- P29320:
-
- QLVGMLRG
- RDLAARN
- GAGEFGEV
- DTGGRKD
- CKETFNL
- RKFTSASD
- LEDDPEAAYTT
- KKCPFTV
- AHTNYTFE
- TTNQAAPS
- GYTEKQRRDFL
- FEFETSP
- GMKYLSDM
- SDVWSYGI
- AQKIYVE
- NVRFLPRQ
- DTIAADE
- MIVTEYMENGSLD
- LAMFPDT
- LDKLIRNP
- ALVSVRV
- FAKELDA
- TYQVCNV
- QETSYTI
- EGEWLVPIGKC
- NWLRTNW
- RARTAAGYG
- AAARPSNLLLDQSN
- YRLPPPMDCP
- LEGVVTKS
- SLVEVRG
- QAVHEFAKE
- NLVCKVSDFGLSR
- MSNQDVI
- WEVMSYGERPY
- KDRTSRNS
- LSWQEPEHPNG
- KFTLRDCNS
- SGMKYLSDM
- RPKFEQIV
- IFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKI
- QNNWLRT
- RWTSPEA
- GLTNTTVTV
- CNAGYEER
- LAFQDVGAC
- GFYLAFQD
- NIIRLEGV
- PNGIILDYE
- YEVKYYEK
- YVFQIRA
- EASIMGQF
- GWEEISG
- QLMLDCW
- LMLDCWQK
- DPHTYEDP
- SYGERPYW
- IMGQFDHPNII
- AAVSITT
- DMGYVHRDLAARNIL
- LDYEVKY
- ACRPGFYKA
Post-translational modifications for EPHA3 Gene
- Autophosphorylates upon activation by EFNA5. Phosphorylation on Tyr-602 mediates interaction with NCK1. Dephosphorylated by PTPN1.
- Glycosylation at Asn232, Asn337, posLast=391391, posLast=404404, and Asn493
Other Protein References for EPHA3 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for EPHA3 (EphA3)
- Cell Signaling Technology (CST) Antibodies for EPHA3 (EphA3)
-
Custom Antibody ServicesOriGene Antibodies for EPHA3
- Novus Biologicals Antibodies for EPHA3
-
Abcam antibodies for EPHA3
-
Cloud-Clone Corp. Antibodies for EPHA3
- Invitrogen Antibodies for EPHA3
- antibodies-online: Search results for 138 available EPH Receptor A3 Antibodies ranked by validation data
- Compare Top EPH Receptor A3 Antibodies
-
Recommended
- 2 IHC Antibodies (anti-rat)
- 3 IHC (p) Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 20 WB Antibodies (anti-rat)
- 2 IHC Antibodies (anti-human)
- 5 IHC (p) Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 89 WB Antibodies (anti-human)
- 2 IHC Antibodies (anti-mouse)
- 3 IHC (p) Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 40 WB Antibodies (anti-mouse)
- GeneTex EPHA3 antibody for EPHA3
-
Santa Cruz Biotechnology (SCBT) Antibodies for EPHA3
- Sino Biological Antibodies for EPHA3
Protein Products
- R&D Systems Proteins and Enzymes for EPHA3 (EphA3)
- Search Origene for MassSpec and Protein Over-expression Lysates for EPHA3
- Origene Custom Protein Services for EPHA3
- Novus Biologicals lysates for EPHA3
- Sino Biological Cell Lysates for EPHA3
- Sino Biological Recombinant Proteins for EPHA3
-
Cloud-Clone Corp. Proteins for EPHA3
- Search GeneTex for Proteins for EPHA3
-
Abcam proteins for EPHA3
Assay Products
- R&D Systems Proteome Profiler Antibody Arrays and other biochemical assays for EPHA3 (EphA3)
-
Cloud-Clone Corp. Assay Kits for EPHA3
Domains & Families for EPHA3 Gene
Gene Families for EPHA3 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted membrane proteins
- Predicted secreted proteins
Protein Domains for EPHA3 Gene
- InterPro:
-
- Ig-like_fold
- Kinase-like_dom_sf
- Prot_kinase_dom
- Protein_kinase_ATP_BS
- Ser-Thr/Tyr_kinase_cat_dom
- Tyr_kinase_AS
- FN3_dom
- FN3_sf
- Tyr_kinase_cat_dom
- Growth_fac_rcpt_cys_sf
- Galactose-bd-like_sf
- SAM/pointed_sf
- SAM
- Tyr_kinase_ephrin_rcpt
- Eph_TM
- Ephrin_rcpt_lig-bd_dom
- Tyr-kin_ephrin_A/B_rcpt-like
- Tyr_kinase_rcpt_V_CS
- EphA3_rcpt_lig-bd
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for EPHA3 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P29320UniProtKB/Swiss-Prot:
EPHA3_HUMAN :- Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Function for EPHA3 Gene
Molecular function for EPHA3 Gene
- GENATLAS Biochemistry:
- EPH-related tyrosine kinase receptor binding ephrins A,expressed in projecting neurons and their target fields,involved in short-range contact-mediated axonal guidance,expressed by some pre-B and T cell lines,not detectable on normal adult human tissues
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
- UniProtKB/Swiss-Prot Function:
- Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.
Enzyme Numbers (IUBMB) for EPHA3 Gene
Phenotypes From GWAS Catalog for EPHA3 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004672 | protein kinase activity | IEA | -- |
GO:0004713 | protein tyrosine kinase activity | IEA | -- |
GO:0004714 | transmembrane receptor protein tyrosine kinase activity | IEA | -- |
GO:0005003 | ephrin receptor activity | IEA | -- |
GO:0005004 | GPI-linked ephrin receptor activity | IDA | 11870224 |
Phenotypes for EPHA3 Gene
- MGI mutant phenotypes for EPHA3:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for EPHA3:
-
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Increased transferrin (TF) endocytosis
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased cell migration
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased cell migration
- Decreased cella89culturea89derived Hepatitis C virus (HCVcc
- Decreased Hepatitis C Virus pseudoparticles (HCVpp
Animal Models for EPHA3 Gene
- MGI Knock Outs for EPHA3:
-
- Epha3 tm1Abn
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for EPHA3
-
-
ViGene Biosciences lentiviral particle packaged cDNA for EPHA3 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA3 gene
- Search ViGene Biosciences for EPHA3
CRISPR Products
-
OriGene CRISPR knockouts for EPHA3
- Applied Biological Materials CRISPR for EPHA3
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for EPHA3
- GenScript: Design CRISPR guide RNA sequences for EPHA3
miRNA Products
- Search ViGene Biosciences for EPHA3
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for EPHA3
- Browse OriGene Inhibitory RNA Products For EPHA3
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA3 gene
Clone Products
- Sino Biological Human cDNA Clone for EPHA3
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for EPHA3
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA3
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for EPHA3
- genomics-online: cdna clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- orf clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- Applied Biological Materials Clones for EPHA3
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
- R&D Systems cDNA Clones for EPHA3 (EphA3)
Cell Line Products
-
Horizon Cell Lines for EPHA3
-
ViGene Biosciences adenoviral particle packaged cDNA for EPHA3 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for EPHA3 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA3 gene
No data available for Human Phenotype Ontology , miRNA , Transcription Factor Targets and HOMER Transcription for EPHA3 Gene
Localization for EPHA3 Gene
Subcellular locations from UniProtKB/Swiss-Prot for EPHA3 Gene
- Isoform 1: Cell membrane; Single-pass type I membrane protein.
- Isoform 2: Secreted.
- Cytosol (1)
- Golgi apparatus (1)
- Nucleoplasm (1)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005576 | extracellular region | IEA | -- |
GO:0005769 | early endosome | IDA | 21135139 |
GO:0005886 | plasma membrane | TAS | -- |
GO:0005887 | integral component of plasma membrane | IDA,IEA | 11870224 |
GO:0016020 | membrane | IEA | -- |
Pathways & Interactions for EPHA3 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | GPCR Pathway |
.73
.62
|
.55
|
2 | ERK Signaling |
.61
.58
|
.49
|
3 | Nanog in Mammalian ESC Pluripotency |
.61
|
.48
|
4 | EPHA forward signaling | ||
5 | MAPK-Erk Pathway |
.38
|
Pathways by source for EPHA3 Gene
3 Sino Biological pathways for EPHA3 Gene
1 Cell Signaling Technology pathway for EPHA3 Gene
3 BioSystems pathways for EPHA3 Gene
5 Reactome pathways for EPHA3 Gene
1 KEGG pathway for EPHA3 Gene
3 GeneGo (Thomson Reuters) pathways for EPHA3 Gene
Interacting Proteins for EPHA3 Gene
SIGNOR curated interactions for EPHA3 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | IEA | -- |
GO:0007155 | cell adhesion | IEA | -- |
GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | IEA | -- |
GO:0010717 | regulation of epithelial to mesenchymal transition | ISS | -- |
GO:0010976 | positive regulation of neuron projection development | IMP | 17910947 |
Drugs & Compounds for EPHA3 Gene
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for EPHA3 Gene
mRNA/cDNA for EPHA3 Gene
- (4) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (45) Selected AceView cDNA sequences:
- (3) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for EPHA3
- Applied Biological Materials CRISPR for EPHA3
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for EPHA3
- GenScript: Design CRISPR guide RNA sequences for EPHA3
miRNA Products
- Search ViGene Biosciences for EPHA3
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for EPHA3
- Browse OriGene Inhibitory RNA Products For EPHA3
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA3 gene
Clone Products
- Sino Biological Human cDNA Clone for EPHA3
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for EPHA3
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA3
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for EPHA3
- genomics-online: cdna clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- orf clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- Applied Biological Materials Clones for EPHA3
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
- R&D Systems cDNA Clones for EPHA3 (EphA3)
Expression for EPHA3 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Brain (Nervous System)
- Neural Tube (Nervous System)
- Skeletal Muscle (Muscoskeletal System)
-
Bone (Muscoskeletal System)
- Chondrocytes Zeugopod Epiphyseal End
-
Cartilage (Muscoskeletal System)
- Chondrocytes Zeugopod Epiphyseal End
-
Kidney (Urinary System)
- Ureteric Bud Cells Ureteric Bud
-
Heart (Cardiovascular System)
- Cushion Mesenchymal Cells Endocardium
-
Eye (Sensory Organs)
- Type1 Off Cone Bipolar Cells Inner Nuclear Layer
-
Neurons
- Type1 Off Cone Bipolar Cells Inner Nuclear Layer
- Gut Tube (Gastrointestinal Tract)
- Neural Ectoderm (Nervous System)
- NULL (Uncategorized)
-
Dermis (Integumentary System)
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EPHA3 Gene
NURSA nuclear receptor signaling pathways regulating expression of EPHA3 Gene:
EPHA3SOURCE GeneReport for Unigene cluster for EPHA3 Gene:
Hs.123642mRNA Expression by UniProt/SwissProt for EPHA3 Gene:
P29320-EPHA3_HUMANEvidence on tissue expression from TISSUES for EPHA3 Gene
- Nervous system(3.2)
Primer Products
-
OriGene qPCR primer pairs and template standards for EPHA3
-
OriGene qPCR primer pairs for EPHA3
- genomics-online: primer clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for EPHA3 Gene
Orthologs for EPHA3 Gene
This gene was present in the common ancestor of animals.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | EPHA3 34 33 |
|
OneToOne | |
oppossum (Monodelphis domestica) |
Mammalia | EPHA3 34 |
|
OneToOne | |
cow (Bos Taurus) |
Mammalia | EPHA3 34 33 |
|
OneToOne | |
rat (Rattus norvegicus) |
Mammalia | Epha3 33 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | EPHA3 34 |
|
OneToOne | |
mouse (Mus musculus) |
Mammalia | Epha3 34 16 33 |
|
OneToOne | |
dog (Canis familiaris) |
Mammalia | EPHA3 33 |
|
||
chicken (Gallus gallus) |
Aves | EPHA3 34 33 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | EPHA3 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | epha3 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | epha3 34 |
|
OneToOne | |
fruit fly (Drosophila melanogaster) |
Insecta | Eph 35 |
|
|
|
hop 35 |
|
|
|||
worm (Caenorhabditis elegans) |
Secernentea | W04G5.10 35 |
|
|
|
old-1 35 |
|
|
|||
old-2 35 |
|
|
|||
sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.498 33 |
|
- Species where no ortholog for EPHA3 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for EPHA3 Gene
Paralogs for EPHA3 Gene
(46) SIMAP similar genes for EPHA3 Gene using alignment to 4 proteins:
- EPHA6
- EPHA4
- EPHA7
- EPHA5
- EPHB1
- EPHB2 variant protein
- EPHA8
- EPHB2
- EPHB3
- EPHA2
- ABL1
- FGR
- EPHA10
- FES
- FYN
- EPHB4
- SRC
- tec
- HCK
- MET
- BTK kinase deficient isoform 6
- EPHA1
- EPHB6
- BLK
- YES1
- LYN
- FRK
- BRAF
- LCK
- PTK6
- MST1R
- DKFZp434L0319
- SRMS
- CSK
- BTK kinase deficient isoform 4
- BTK kinase deficient isoform 2
- lsk
- TNK2
- PTK7
- urf-ret
- DKFZp686M05208
- FGFR2
- NUAK1
- ERBB4
- TIE1
- FGFR1
Variants for EPHA3 Gene
SNP ID | Clin | Chr 03 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs200567888 | A pancreatic ductal adenocarcinoma sample | 89,210,327(+) | G/T | coding_sequence_variant, missense_variant | |
rs372594677 | A lung carcinoma sample | 89,472,571(+) | C/A/T | coding_sequence_variant, genic_downstream_transcript_variant, intron_variant, missense_variant | |
VAR_036086 | A colorectal cancer sample | p.Thr37Lys | |||
VAR_036087 | A colorectal cancer sample | p.Asn85Ser | |||
VAR_036088 | A colorectal cancer sample | p.Ile621Leu |
Additional Variant Information for EPHA3 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EPHA3 Gene
Disorders for EPHA3 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
beriberi |
|
|
kummell's disease |
|
|
ariboflavinosis |
|
|
myelophthisic anemia |
|
|
cerebral artery occlusion |
|
|
UniProtKB/Swiss-Prot
EPHA3_HUMAN- Colorectal cancer (CRC) [MIM:114500]: A complex disease characterized by malignant lesions arising from the inner wall of the large intestine (the colon) and the rectum. Genetic alterations are often associated with progression from premalignant lesion (adenoma) to invasive adenocarcinoma. Risk factors for cancer of the colon and rectum include colon polyps, long-standing ulcerative colitis, and genetic family history. {ECO:0000269 PubMed:12738854}. Note=The gene represented in this entry may be involved in disease pathogenesis.
Additional Disease Information for EPHA3
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for EPHA3 Gene
Publications for EPHA3 Gene
- Autoregulation by the juxtamembrane region of the human ephrin receptor tyrosine kinase A3 (EphA3). (PMID: 18547520) Davis TL … Dhe-Paganon S (Structure (London, England : 1993) 2008) 3 4 22 58
- Identification of a tumor-specific shared antigen derived from an Eph receptor and presented to CD4 T cells on HLA class II molecules. (PMID: 10987298) Chiari R … Coulie PG (Cancer research 2000) 3 4 22 58
- Molecular cloning of HEK, the gene encoding a receptor tyrosine kinase expressed by human lymphoid tumor cell lines. (PMID: 1311845) Wicks IP … Boyd AW (Proceedings of the National Academy of Sciences of the United States of America 1992) 2 3 4 58
- Isolation and characterization of a novel receptor-type protein tyrosine kinase (hek) from a human pre-B cell line. (PMID: 1737782) Boyd AW … Busmanis I (The Journal of biological chemistry 1992) 2 3 4 58
- Mutational profiling of kinases in human tumours of pancreatic origin identifies candidate cancer genes in ductal and ampulla of vater carcinomas. (PMID: 20838624) Corbo V … Scarpa A (PloS one 2010) 3 4 58
Products for EPHA3 Gene
- R&D Systems Antibodies for EPHA3 (EphA3)
- R&D Systems Proteins and Enzymes for EPHA3 (EphA3)
- R&D Systems Proteome Profiler Antibody Arrays and other biochemical assays for EPHA3 (EphA3)
- R&D Systems cDNA Clones for EPHA3 (EphA3)
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for EPHA3
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for EPHA3
- Origene Custom Protein Services for EPHA3
- Origene shrna, sirna, and RNAi products in human, mouse, rat for EPHA3
- Browse OriGene Inhibitory RNA Products For EPHA3
- OriGene qPCR primer pairs and template standards for EPHA3
- OriGene qPCR primer pairs for EPHA3
- OriGene CRISPR knockouts for EPHA3
- OriGene ORF clones in human for EPHA3
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For EPHA3
- GenScript: Next-day shipping of latest version cDNA ORF clones for EPHA3 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for EPHA3
- GenScript Custom Assay Services for EPHA3
- GenScript Custom overexpressing Cell Line Services for EPHA3
- GenScript: Design CRISPR guide RNA sequences for EPHA3
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for EPHA3
- Cell Signaling Technology (CST) Antibodies for EPHA3 (EphA3)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for EPHA3
- Sino Biological Cell Lysates for EPHA3
- Sino Biological Recombinant Proteins for EPHA3
- Sino Biological Antibodies for EPHA3
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for EPHA3
- Novus Biologicals lysates for EPHA3
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for EPHA3
- Abcam proteins for EPHA3
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for EPHA3
- Cloud-Clone Corp. Proteins for EPHA3
- Cloud-Clone Corp. Assay Kits for EPHA3
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for EPHA3
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for EPHA3
- VectorBuilder custom plasmid, inducible vectors for EPHA3
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA3
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for EPHA3
- antibodies-online: Search results for 138 available EPH Receptor A3 Antibodies ranked by validation data
- Compare Top EPH Receptor A3 Antibodies
- Recommended
- 40 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 3 IHC (p) Antibodies (anti-mouse)
- 2 IHC Antibodies (anti-mouse)
- 89 WB Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 5 IHC (p) Antibodies (anti-human)
- 2 IHC Antibodies (anti-human)
- 20 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 3 IHC (p) Antibodies (anti-rat)
- 2 IHC Antibodies (anti-rat)
- antibodies-online: Search results for 18 available EPH Receptor A3 Elisa Kits ranked by validation data
- Compare Top EPH Receptor A3 Elisa Kits
- antibodies-online: Search results for 24 available EPH Receptor A3 Proteins ranked by validation data
- Compare Top EPH Receptor A3 Proteins
- GeneTex EPHA3 antibody for EPHA3
- Search GeneTex for Proteins for EPHA3
- ViGene Biosciences adenoviral particle packaged cDNA for EPHA3 gene
- ViGene Biosciences lentiviral particle packaged cDNA for EPHA3 gene
- ViGene Biosciences ready-to-package AAV shRNAs for EPHA3 gene
- Search ViGene Biosciences for EPHA3
- Santa Cruz Biotechnology (SCBT) Antibodies for EPHA3
- Search Santa Cruz Biotechnology (SCBT) for EPHA3 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for EPHA3
- Horizon Cell Lines for EPHA3
- genomics-online: cdna clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- orf clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- genomics-online: gRNA clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- genomics-online: primer clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
- genomics-online: shRNA clones - Search results for 103 available EPH Receptor A3 gene related products
- Overview of 103 available EPH Receptor A3 gene related products
Sources for EPHA3 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew