Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DDX5 Gene

Aliases for DDX5 Gene

  • DEAD-Box Helicase 5 2 3 5
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 5 (RNA Helicase, 68kD) 2 3
  • DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 2 3
  • DEAD (Asp-Glu-Ala-Asp) Box Helicase 5 2 3
  • DEAD Box Protein 5 3 4
  • RNA Helicase P68 3 4
  • G17P1 3 4
  • HLR1 3 4
  • Probable ATP-Dependent RNA Helicase DDX5 3
  • ATP-Dependent RNA Helicase DDX5 3
  • EC 3.6.4.13 4
  • DEAD Box-5 3
  • EC 3.6.1 58
  • HUMP68 3
  • HELR 4
  • P68 3

External Ids for DDX5 Gene

Previous HGNC Symbols for DDX5 Gene

  • HLR1
  • G17P1

Previous GeneCards Identifiers for DDX5 Gene

  • GC17M065876
  • GC17P068976
  • GC17M062913
  • GC17M063045
  • GC17M059926
  • GC17M062494
  • GC17M057943

Summaries for DDX5 Gene

Entrez Gene Summary for DDX5 Gene

  • This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2017]

GeneCards Summary for DDX5 Gene

DDX5 (DEAD-Box Helicase 5) is a Protein Coding gene. Among its related pathways are Translational Control and Proteoglycans in cancer. GO annotations related to this gene include nucleic acid binding and enzyme binding. An important paralog of this gene is DDX17.

UniProtKB/Swiss-Prot for DDX5 Gene

  • Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3 transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.

Gene Wiki entry for DDX5 Gene

Additional gene information for DDX5 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DDX5 Gene

Genomics for DDX5 Gene

Regulatory Elements for DDX5 Gene

Enhancers for DDX5 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17H063837 1.8 FANTOM5 ENCODE dbSUPER 47.6 +667.2 667228 7.4 ZFP64 YBX1 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 SP3 NFYC FTSJ3 POLG2 CEP95 DDX42 ENSG00000265982 DDX5 PLEKHM1P1 SMURF2 SMARCD2 DCAF7
GH17H064501 1.4 ENCODE dbSUPER 59.6 +3.4 3427 7.7 FEZF1 DMAP1 YBX1 YY1 ZNF143 SP3 NFYC ZC3H11A MEF2D SSRP1 POLG2 FTSJ3 DDX42 CEP95 SLC16A6P1 DDX5 SMARCD2 PLEKHM1P1 ENSG00000265982 MAP3K3
GH17H064145 1.4 ENCODE dbSUPER 48 +361.2 361234 4.9 HNRNPUL1 HDGF PKNOX1 FOXA2 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 POLG2 CEP95 FTSJ3 SMARCD2 ENSG00000265982 PLEKHM1P1 SLC16A6P1 DDX42 DDX5 ENSG00000265218
GH17H063621 1.4 ENCODE dbSUPER 40.4 +885.6 885600 3.1 HDGF PKNOX1 ZFP64 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B YY1 ZNF143 FTSJ3 POLG2 CEP95 DDX42 DDX5 SMARCD2 EEF1DP7 MAP3K3 ENSG00000281311 DCAF7
GH17H065099 1.3 ENCODE dbSUPER 31 -592.1 -592079 2.1 HDGF PKNOX1 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B ZNF207 ZNF143 SP3 DDX5 POLG2 PLEKHM1P1 ENSG00000265982 ENSG00000281311 CEP95 SLC16A6P1 ERN1 LOC105371864 GC17P065092
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DDX5 on UCSC Golden Path with GeneCards custom track

Promoters for DDX5 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000096971 1699 3801 FEZF1 DMAP1 YBX1 YY1 ZNF143 SP3 NFYC ZC3H11A MEF2D SSRP1

Genomic Locations for DDX5 Gene

Genomic Locations for DDX5 Gene
chr17:64,498,256-64,508,199
(GRCh38/hg38)
Size:
9,944 bases
Orientation:
Minus strand
chr17:62,494,374-62,504,317
(GRCh37/hg19)

Genomic View for DDX5 Gene

Genes around DDX5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DDX5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DDX5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DDX5 Gene

Proteins for DDX5 Gene

  • Protein details for DDX5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P17844-DDX5_HUMAN
    Recommended name:
    Probable ATP-dependent RNA helicase DDX5
    Protein Accession:
    P17844
    Secondary Accessions:
    • B4DLW8
    • B5BU21
    • D3DU32
    • E7ETL9
    • O75681
    • Q53Y61

    Protein attributes for DDX5 Gene

    Size:
    614 amino acids
    Molecular mass:
    69148 Da
    Quaternary structure:
    • Identified in the spliceosome C complex. Interacts with RBM4; the interaction occurs in an RNA-independent manner. Interacts with AGO1 and AGO2. Interacts with ESR1; the interaction is enhanced by phosphorylation of ESR1 AF-1 domain. Interacts with AR, NCOA1, NCOA2, NCOA3, EP300, CREBBP, POLR2A, TP53, RUNX2 and HDAC1. Self-associates. Interacts with DDX17. Interacts with BRDT. The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active).

    Three dimensional structures from OCA and Proteopedia for DDX5 Gene

    Alternative splice isoforms for DDX5 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DDX5 Gene

Selected DME Specific Peptides for DDX5 Gene

P17844:
  • MRRDGWPAM
  • DMGFEPQ
  • YGGAPKG
  • DEADRML
  • VASRGLD
  • PTRELAQQ
  • VLDEADRM
  • VFVETKR
  • TDVASRG
  • NMHNGMNQQAYAYP
  • QLAEDFL
  • KKFGNPGE
  • LPAIVHIN
  • AQTGSGKT
  • FVETKRRCD
  • LAPTREL
  • HRIGRTAR
  • LELSANHNILQIVDVC
  • TGSGKTLS
  • TPGRLID
  • ILIATDVA
  • LVLDEADR
  • TYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIAR
  • MWSATWPK
  • FEKNFYQEHPD
  • QIRPDRQT
  • IHGDKSQ
  • SATWPKEV
  • VLREANQ
  • APTRELA
  • YSSDRDRGRDRGFGAPRFGGSR
  • GPQIRDL
  • GKTNLRR
  • IATPGRL
  • PKFEKNFY
  • EANQAINPKL
  • YIHRIGR

Post-translational modifications for DDX5 Gene

  • Arg-502 is dimethylated, probably to asymmetric dimethylarginine.
  • Polyubiquitinated, leading to proteasomal degradation.
  • Sumoylated; sumoylation, promoted by PIAS1, promotes interaction with HDAC1 and transcriptional repression activity. Sumoylation also significantly increases stability, and reduces polyubiquitination.
  • Ubiquitination at posLast=5656, posLast=9191, posLast=236236, isoforms=2340, isoforms=2351, isoforms=2375, posLast=388388, isoforms=2411, posLast=437437, isoforms=2451, and isoforms=2529
  • Modification sites at PhosphoSitePlus

Domains & Families for DDX5 Gene

Gene Families for DDX5 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for DDX5 Gene

Graphical View of Domain Structure for InterPro Entry

P17844

UniProtKB/Swiss-Prot:

DDX5_HUMAN :
  • Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
Family:
  • Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
genes like me logo Genes that share domains with DDX5: view

Function for DDX5 Gene

Molecular function for DDX5 Gene

GENATLAS Biochemistry:
DEAD/H box protein 5,putative RNA helicase
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + H(2)O = ADP + phosphate.
UniProtKB/Swiss-Prot Function:
Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3 transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.

Enzyme Numbers (IUBMB) for DDX5 Gene

Phenotypes From GWAS Catalog for DDX5 Gene

Gene Ontology (GO) - Molecular Function for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003676 nucleic acid binding IEA --
GO:0003713 transcription coactivator activity IDA --
GO:0003723 RNA binding IDA,IEA 22658674
GO:0003724 RNA helicase activity NAS 1996094
genes like me logo Genes that share ontologies with DDX5: view
genes like me logo Genes that share phenotypes with DDX5: view

Clone Products

  • Addgene plasmids for DDX5

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for DDX5 Gene

Localization for DDX5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DDX5 Gene

Nucleus, nucleolus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DDX5 gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus NAS 2451786
GO:0005654 nucleoplasm TAS --
GO:0005681 spliceosomal complex IEA --
GO:0005730 nucleolus IEA,IDA 10837141
GO:0005737 cytoplasm IBA --
genes like me logo Genes that share ontologies with DDX5: view

Pathways & Interactions for DDX5 Gene

genes like me logo Genes that share pathways with DDX5: view

Pathways by source for DDX5 Gene

SIGNOR curated interactions for DDX5 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription from RNA polymerase II promoter IDA 15298701
GO:0000380 alternative mRNA splicing, via spliceosome IMP 24275493
GO:0000381 regulation of alternative mRNA splicing, via spliceosome IMP 23022728
GO:0000398 mRNA splicing, via spliceosome TAS --
GO:0000956 nuclear-transcribed mRNA catabolic process IDA 23788676
genes like me logo Genes that share ontologies with DDX5: view

Drugs & Compounds for DDX5 Gene

(6) Drugs for DDX5 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
ATP Nutra Agonist 0

(2) Additional Compounds for DDX5 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with DDX5: view

Transcripts for DDX5 Gene

Unigene Clusters for DDX5 Gene

DEAD (Asp-Glu-Ala-Asp) box helicase 5:
Representative Sequences:

Clone Products

  • Addgene plasmids for DDX5

Alternative Splicing Database (ASD) splice patterns (SP) for DDX5 Gene

ExUns: 1 ^ 2a · 2b ^ 3a · 3b · 3c ^ 4 ^ 5a · 5b · 5c ^ 6a · 6b · 6c ^ 7a · 7b · 7c ^ 8a · 8b ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12a · 12b · 12c ·
SP1: - - - -
SP2:
SP3: - - -
SP4: - - -
SP5:
SP6: -
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: - - - - - - - - - - - - - -
SP13: - - - -
SP14: -
SP15: -
SP16:
SP17:
SP18:
SP19:

ExUns: 12d · 12e · 12f ^ 13 ^ 14a · 14b · 14c · 14d · 14e ^ 15a · 15b ^ 16 ^ 17a · 17b · 17c · 17d ^ 18a · 18b · 18c · 18d
SP1: - - - - - - - - - -
SP2: - - - - - - - - -
SP3:
SP4:
SP5:
SP6:
SP7: - - -
SP8: - - - -
SP9: - - - - - - - -
SP10: - - - - - - -
SP11: - -
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18: - -
SP19:

Relevant External Links for DDX5 Gene

GeneLoc Exon Structure for
DDX5
ECgene alternative splicing isoforms for
DDX5

Expression for DDX5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DDX5 Gene

Protein differential expression in normal tissues from HIPED for DDX5 Gene

This gene is overexpressed in Lymph node (13.1) and Peripheral blood mononuclear cells (7.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DDX5 Gene



Protein tissue co-expression partners for DDX5 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of DDX5 Gene:

DDX5

SOURCE GeneReport for Unigene cluster for DDX5 Gene:

Hs.279806

Evidence on tissue expression from TISSUES for DDX5 Gene

  • Nervous system(5)
  • Lung(4.7)
  • Kidney(4.5)
  • Liver(4.5)
  • Muscle(4.5)
  • Spleen(4.5)
  • Blood(4.4)
  • Intestine(4.4)
  • Pancreas(4.3)
  • Skin(4.3)
  • Eye(4)
  • Stomach(3.9)
  • Heart(3.2)
  • Bone marrow(2.8)
  • Adrenal gland(2.6)
  • Lymph node(2.6)
  • Gall bladder(2.5)
  • Thyroid gland(2.4)
  • Bone(2.3)
genes like me logo Genes that share expression patterns with DDX5: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DDX5 Gene

Orthologs for DDX5 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for DDX5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DDX5 33 34
  • 99.57 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 34
  • 98 (a)
OneToMany
-- 34
  • 94 (a)
OneToMany
dog
(Canis familiaris)
Mammalia DDX5 33 34
  • 96.63 (n)
cow
(Bos Taurus)
Mammalia DDX5 33 34
  • 95.49 (n)
mouse
(Mus musculus)
Mammalia Ddx5 33 16 34
  • 94.08 (n)
rat
(Rattus norvegicus)
Mammalia Ddx5 33
  • 94.08 (n)
oppossum
(Monodelphis domestica)
Mammalia DDX5 34
  • 89 (a)
OneToOne
chicken
(Gallus gallus)
Aves DDX5 33 34
  • 83.11 (n)
lizard
(Anolis carolinensis)
Reptilia -- 34
  • 89 (a)
OneToMany
-- 34
  • 82 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia ddx5 33
  • 74.51 (n)
MGC76265 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.648 33
zebrafish
(Danio rerio)
Actinopterygii ddx5 33 34
  • 73.59 (n)
Dr.28420 33
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.10528 33
fruit fly
(Drosophila melanogaster)
Insecta Rm62 35 34
  • 65 (a)
CG10077 35 33 34
  • 59.93 (n)
CG10777 35 34
  • 58 (a)
CG14443 35
  • 32 (a)
worm
(Caenorhabditis elegans)
Secernentea F58E10.3 35
  • 59 (a)
ddx-17 34
  • 50 (a)
OneToMany
F58G11.2 35
  • 30 (a)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F23716g 33
  • 61.02 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AFL221C 33
  • 58.42 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes DBP2 33 34 36
  • 57.99 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G55150 33
  • 60.09 (n)
barley
(Hordeum vulgare)
Liliopsida Hv.9145 33
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes dbp2 33
  • 58.94 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU07839 33
  • 57.72 (n)
Species where no ortholog for DDX5 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DDX5 Gene

ENSEMBL:
Gene Tree for DDX5 (if available)
TreeFam:
Gene Tree for DDX5 (if available)

Paralogs for DDX5 Gene

Variants for DDX5 Gene

Sequence variations from dbSNP and Humsavar for DDX5 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs1000057115 -- 64,500,456(+) ACATT(C/G)AAGGT intron-variant, downstream-variant-500B
rs1000267629 -- 64,507,534(+) CCCTG(C/T)AGAAT intron-variant, upstream-variant-2KB
rs1000479703 -- 64,504,972(+) CTGTC(C/T)TTCGT intron-variant, upstream-variant-2KB
rs1000677464 -- 64,506,917(+) GTGCT(A/C)CTCTG nc-transcript-variant, upstream-variant-2KB, utr-variant-5-prime
rs1000748155 -- 64,507,756(+) AATAC(A/C)CTCTC intron-variant, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for DDX5 Gene

Variant ID Type Subtype PubMed ID
nsv475380 CNV novel sequence insertion 20440878

Variation tolerance for DDX5 Gene

Residual Variation Intolerance Score: 9.84% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.19; 51.99% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DDX5 Gene

Human Gene Mutation Database (HGMD)
DDX5
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DDX5

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DDX5 Gene

Disorders for DDX5 Gene

Relevant External Links for DDX5

Genetic Association Database (GAD)
DDX5
Human Genome Epidemiology (HuGE) Navigator
DDX5
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DDX5

No disorders were found for DDX5 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for DDX5 Gene

Publications for DDX5 Gene

  1. Sumoylation of p68 and p72 RNA helicases affects protein stability and transactivation potential. (PMID: 19995069) Mooney SM … Janknecht R (Biochemistry 2010) 3 4 22 60
  2. The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer. (PMID: 19718048) Wortham NC … Fuller-Pace FV (Oncogene 2009) 3 4 22 60
  3. P68 RNA helicase (DDX5) alters activity of cis- and trans-acting factors of the alternative splicing of H-Ras. (PMID: 18698352) Camats M … Bach-Elias M (PloS one 2008) 2 3 22 60
  4. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. (PMID: 17960593) Jensen ED … Westendorf JJ (Journal of cellular biochemistry 2008) 3 4 22 60
  5. SUMO modification of the DEAD box protein p68 modulates its transcriptional activity and promotes its interaction with HDAC1. (PMID: 17369852) Jacobs AM … Fuller-Pace FV (Oncogene 2007) 3 4 22 60

Products for DDX5 Gene