Aliases for CYP2D6 Gene
Aliases for CYP2D6 Gene
- Cytochrome P450 Family 2 Subfamily D Member 6 2 3 5
- Cytochrome P450, Subfamily IID (Debrisoquine, Sparteine, Etc., -Metabolising), Polypeptide 8 Pseudogene 2 2 3
- Cytochrome P450, Subfamily II (Debrisoquine, Sparteine, Etc., -Metabolising), Polypeptide 7 Pseudogene 2 2 3
- Cytochrome P450, Subfamily IID (Debrisoquine, Sparteine, Etc., -Metabolizing), Polypeptide 6 2 3
- Cytochrome P450, Family 2, Subfamily D, Polypeptide 7 Pseudogene 2 2 3
- Cytochrome P450, Family 2, Subfamily D, Polypeptide 8 Pseudogene 2 2 3
- Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 2 3
- Cholesterol 25-Hydroxylase 3 4
- Debrisoquine 4-Hydroxylase 3 4
- Cytochrome P450-DB1 3 4
- EC 1.14.14.1 4 56
- CYP2DL1 3 4
- CYPIID6 3 4
- Cytochrome P450, Subfamily IID (Debrisoquine, Sparteine, Etc., -Metabolizing)-Like 1 3
- Flavoprotein-Linked Monooxygenase 3
External Ids for CYP2D6 Gene
- HGNC: 2625
- Entrez Gene: 1565
- Ensembl: ENSG00000100197
- OMIM: 124030
- UniProtKB: P10635
Previous HGNC Symbols for CYP2D6 Gene
- CYP2DL1
- CYP2D7P2
- CYP2D7BP
- CYP2D8P2
- CYP2D7AP
Previous GeneCards Identifiers for CYP2D6 Gene
- GC22U990011
- GC22M039139
- GC22M040766
- GC22M040768
- GC22M040769
- GC22M040848
- GC22M040849
- GC22M040852
- GC22M042522
- GC22M025488
- GC22M042126
- GC22M042131
Summaries for CYP2D6 Gene
-
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 25% of commonly prescribed drugs. Its substrates include antidepressants, antipsychotics, analgesics and antitussives, beta adrenergic blocking agents, antiarrythmics and antiemetics. The gene is highly polymorphic in the human population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. Some individuals with the poor metabolizer phenotype have no functional protein since they carry 2 null alleles whereas in other individuals the gene is absent. This gene can vary in copy number and individuals with the ultrarapid metabolizer phenotype can have 3 or more active copies of the gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
GeneCards Summary for CYP2D6 Gene
CYP2D6 (Cytochrome P450 Family 2 Subfamily D Member 6) is a Protein Coding gene. Diseases associated with CYP2D6 include Drug Metabolism, Poor, Cyp2d6-Related and Codeine Toxicity. Among its related pathways are Gefitinib Pathway, Pharmacokinetics and Melatonin metabolism and effects. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and heme binding. An important paralog of this gene is CYP2D7.
UniProtKB/Swiss-Prot for CYP2D6 Gene
-
Responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It is involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.
Additional gene information for CYP2D6 Gene
- Monarch Initiative
- Search for CYP2D6 at DataMed
- Search for CYP2D6 at HumanCyc
No data available for Tocris Summary , fRNAdb sequence ontologies and piRNA Summary for CYP2D6 Gene
Genomics for CYP2D6 Gene
GeneHancer (GH) Regulatory Elements for CYP2D6 Gene
- Top Transcription factor binding sites by QIAGEN in the CYP2D6 gene promoter:
Regulatory Element Products
Genomic Locations for CYP2D6 Gene
- chr22:42,125,656-42,135,378
- (GRCh38/hg38)
- Size:
- 9,723 bases
- Orientation:
- Minus strand
- chr22:42,522,501-42,526,908
- (GRCh37/hg19)
Genomic View for CYP2D6 Gene
- Cytogenetic band:
-
- 22q13.2 by Ensembl
- 22q13.2 by Entrez Gene
- 22q13.2 by HGNC


RefSeq DNA sequence for CYP2D6 Gene
Proteins for CYP2D6 Gene
-
Protein details for CYP2D6 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P10635-CP2D6_HUMAN
- Recommended name:
- Cytochrome P450 2D6
- Protein Accession:
- P10635
- Q16752
- Q2XND6
- Q2XND7
- Q2XNE0
- Q6B012
- Q6NXU8
Protein attributes for CYP2D6 Gene
- Size:
- 497 amino acids
- Molecular mass:
- 55769 Da
- Cofactor:
- Name=heme; Xref=ChEBI:CHEBI:30413;
- Quaternary structure:
- No Data Available
Three dimensional structures from OCA and Proteopedia for CYP2D6 Gene
Protein Expression for CYP2D6 Gene
Selected DME Specific Peptides for CYP2D6 Gene
- P10635:
-
- EAFLPFS
- VTTSTTL
- EKAKGNPESSFND
- NTPYCFDQLRRRFG
- TSRDIEVQ
- QLDELLTEHRMTWDPAQPPRDLTEAFLAEMEK
- RFHPEHFLDAQG
- PFSAGRRACLGEPLARMELFLFFT
- NLSSVLK
- AVIHEVQRF
- GEDTADRPPVPI
- GRPFRPNGLLDKAVSNVIASLTC
- GLGKKSLEQWVT
- GKKSLEQWVTEEA
- LARYGPAWR
- TLAWGLLLMILHPDVQRRVQQEIDDVIG
- LLVDLMHRRQRWAARYPPGP
- VIGQVRRPEM
- LSSVLKD
- GRRFEYDDPR
Post-translational modifications for CYP2D6 Gene
Other Protein References for CYP2D6 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for CYP2D6 (CYP2D6)
- Novus Biologicals Antibodies for CYP2D6
-
Abcam antibodies for CYP2D6
-
Cloud-Clone Corp. Antibodies for CYP2D6
- Invitrogen Antibodies for CYP2D6
- GeneTex CYP2D6 antibody for CYP2D6
-
Santa Cruz Biotechnology (SCBT) Antibodies for CYP2D6
Protein Products
-
OriGene Purified Proteins for CYP2D6
- Search Origene for MassSpec and Protein Over-expression Lysates for CYP2D6
- Origene Custom Protein Services for CYP2D6
- ProSpec Recombinant Proteins for CYP2D6
-
Cloud-Clone Corp. Proteins for CYP2D6
- Search GeneTex for Proteins for CYP2D6
-
Abcam proteins for CYP2D6
Assay Products
-
Cloud-Clone Corp. Assay Kits for CYP2D6
- antibodies-online: Search results for 11 available CYP2D6 Elisa Kits ranked by validation data
- Compare Top CYP2D6 Elisa Kits
-
Quality Products:
-
Abcam assays for CYP2D6
Domains & Families for CYP2D6 Gene
Gene Families for CYP2D6 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for CYP2D6 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for CYP2D6 Gene
- GenScript: Design optimal peptide antigens:
-
- Nonfunctional cytochrome P450 family 2 subfamily D polypeptide 6 (A9QKR9_HUMAN)
- Cytochrome P450, family 2, subfamily D, polypeptide 6, isoform CRA_a (C1ID52_HUMAN)
- Cytochrome P450 2D6 (C1ID54_HUMAN)
- Nonfunctional cytochrom P450 family 2 subfamily D polypeptide 6 (C4MDQ5_HUMAN)
- Debrisoquine 4-hydroxylase (CP2D6_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P10635- Family:
-
- Belongs to the cytochrome P450 family.
Function for CYP2D6 Gene
Molecular function for CYP2D6 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.
- UniProtKB/Swiss-Prot Function:
- Responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It is involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.
- UniProtKB/Swiss-Prot Induction:
- By pregnancy.
Enzyme Numbers (IUBMB) for CYP2D6 Gene
Phenotypes From GWAS Catalog for CYP2D6 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004497 | monooxygenase activity | IDA | 15327587 |
GO:0005506 | iron ion binding | IEA | -- |
GO:0008144 | drug binding | IDA | 19448135 |
GO:0008395 | steroid hydroxylase activity | IBA | -- |
GO:0016491 | oxidoreductase activity | IDA,IEA | 15039299 |
Phenotypes for CYP2D6 Gene
- GenomeRNAi human phenotypes for CYP2D6:
Animal Model Products
-
Taconic Biosciences Mouse Models for CYP2D6
- Cyagen custom Knockout/knockin (KOKI) mouse models for CYP2D6
-
-
ViGene Biosciences lentiviral particle packaged cDNA for CYP2D6 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CYP2D6 gene
- Search ViGene Biosciences for CYP2D6
CRISPR Products
-
OriGene CRISPR knockouts for CYP2D6
- genomics-online: gRNA clones - Search results for available CYP2D6 gene related products
- Applied Biological Materials CRISPR for CYP2D6
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for CYP2D6
- GenScript: Design CRISPR guide RNA sequences for CYP2D6
miRNA for CYP2D6 Gene
- miRTarBase miRNAs that target CYP2D6
miRNA Products
- Search ViGene Biosciences for CYP2D6
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CYP2D6
- Browse OriGene Inhibitory RNA Products For CYP2D6
- genomics-online: shRNA clones - Search results for available CYP2D6 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for CYP2D6 gene
Clone Products
- Sino Biological Human cDNA Clone for CYP2D6
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CYP2D6
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CYP2D6
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for CYP2D6
- genomics-online: cdna clones - Search results for available CYP2D6 gene related products
- orf clones - Search results for available CYP2D6 gene related products
- Applied Biological Materials Clones for CYP2D6
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for CYP2D6
-
ViGene Biosciences adenoviral particle packaged cDNA for CYP2D6 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for CYP2D6 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CYP2D6 gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CYP2D6 Gene
Localization for CYP2D6 Gene
Subcellular locations from UniProtKB/Swiss-Prot for CYP2D6 Gene
- Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
- Golgi apparatus (2)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005739 | mitochondrion | IDA | 19438707 |
GO:0005783 | endoplasmic reticulum | TAS | 19438707 |
GO:0005789 | endoplasmic reticulum membrane | TAS | -- |
GO:0016020 | membrane | IEA | -- |
GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for CYP2D6 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Cytochrome P450 - arranged by substrate type |
.39
|
.01
.01
|
2 | Clomipramine Pathway, Pharmacokinetics | ||
3 | Drug metabolism - cytochrome P450 | ||
4 | Gefitinib Pathway, Pharmacokinetics | ||
5 | Acetaminophen Pathway (therapeutic doses), Pharmacokinetics |
Pathways by source for CYP2D6 Gene
1 Cell Signaling Technology pathway for CYP2D6 Gene
6 BioSystems pathways for CYP2D6 Gene
8 Reactome pathways for CYP2D6 Gene
30 PharmGKB pathways for CYP2D6 Gene
4 KEGG pathways for CYP2D6 Gene
4 GeneGo (Thomson Reuters) pathways for CYP2D6 Gene
Interacting Proteins for CYP2D6 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006629 | lipid metabolic process | IEA | -- |
GO:0006805 | xenobiotic metabolic process | TAS | 19438707 |
GO:0008202 | steroid metabolic process | IMP | 18356043 |
GO:0009804 | coumarin metabolic process | IDA | 19438707 |
GO:0009820 | alkaloid metabolic process | IDA | 19651758 |
No data available for SIGNOR curated interactions for CYP2D6 Gene
Drugs & Compounds for CYP2D6 Gene
(580) Drugs for CYP2D6 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, FDA Approved Drugs, HMDB, and Novoseek
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Aripiprazole | Approved, Investigational | Pharma | Antagonist, Enzyme, substrate, inhibitor, inducer | Antipsychotic, High affinity D2 and 5-HT1A receptor partial agonist; also 5-HT2A antagonist | 373 | |
Citalopram | Approved | Pharma | Enzyme, substrate, inhibitor | 526 | ||
Clomipramine | Approved, Investigational, Vet_approved | Pharma | Enzyme, substrate, inhibitor | 24 | ||
Codeine | Approved, Illicit | Pharma | Full agonist, Agonist, Enzyme, substrate, inhibitor | 83 | ||
Desipramine | Approved, Investigational | Pharma | Enzyme, substrate, inhibitor | 39 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
nadph |
|
53-57-6 | ||||
Paraxanthine |
|
611-59-6 | ||||
11,12,15-THETA |
|
|
||||
11,12-Epoxyeicosatrienoic acid |
|
81276-02-0 |
|
|||
11,14,15-THETA |
|
|
(4) ApexBio Compounds for CYP2D6 Gene
Compound | Action | Cas Number |
---|---|---|
Abiraterone acetate | Cytochrome p450 17a1 inhibitor | 154229-18-2 |
Avasimibe | ACAT inhibitor,orally bioavailable | 166518-60-1 |
Ifosfamide | Cytostatic agent | 3778-73-2 |
Ketoconazole | Inhibitor of cyclosporine oxidase and testosterone 6 beta-hydroxylase | 65277-42-1 |
Transcripts for CYP2D6 Gene
mRNA/cDNA for CYP2D6 Gene
- (6) REFSEQ mRNAs :
- (24) Additional mRNA sequences :
- (107) Selected AceView cDNA sequences:
- (5) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for CYP2D6 Gene
CRISPR Products
-
OriGene CRISPR knockouts for CYP2D6
- genomics-online: gRNA clones - Search results for available CYP2D6 gene related products
- Applied Biological Materials CRISPR for CYP2D6
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for CYP2D6
- GenScript: Design CRISPR guide RNA sequences for CYP2D6
miRNA Products
- Search ViGene Biosciences for CYP2D6
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CYP2D6
- Browse OriGene Inhibitory RNA Products For CYP2D6
- genomics-online: shRNA clones - Search results for available CYP2D6 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for CYP2D6 gene
Clone Products
- Sino Biological Human cDNA Clone for CYP2D6
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CYP2D6
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CYP2D6
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for CYP2D6
- genomics-online: cdna clones - Search results for available CYP2D6 gene related products
- orf clones - Search results for available CYP2D6 gene related products
- Applied Biological Materials Clones for CYP2D6
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1 | ^ | 2a | · | 2b | ^ | 3a | · | 3b | · | 3c | ^ | 4 | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9a | · | 9b | · | 9c | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | · | 13c | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17a | · |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP2: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||
SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP8: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP11: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
SP12: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP13: | - | - |
ExUns: | 17b | ^ | 18 | ^ | 19 | ^ | 20a | · | 20b | ^ | 21 |
---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | |||||||||||
SP2: | |||||||||||
SP3: | |||||||||||
SP4: | |||||||||||
SP5: | |||||||||||
SP6: | - | ||||||||||
SP7: | |||||||||||
SP8: | |||||||||||
SP9: | |||||||||||
SP10: | |||||||||||
SP11: | - | - | - | - | - | ||||||
SP12: | |||||||||||
SP13: |
Expression for CYP2D6 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Liver (Hepatobiliary System)
- Mature Hepatocytes Liver Lobule
-
Amnion (Extraembryonic Tissues)
- Amniotic Epithelial Cells Amniotic Membrane
-
Epithelial Cells
- Amniotic Epithelial Cells Amniotic Membrane
mRNA differential expression in normal tissues according to GTEx for CYP2D6 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for CYP2D6 Gene
NURSA nuclear receptor signaling pathways regulating expression of CYP2D6 Gene:
CYP2D6SOURCE GeneReport for Unigene cluster for CYP2D6 Gene:
Hs.333497Evidence on tissue expression from TISSUES for CYP2D6 Gene
- Liver(4.9)
- Nervous system(3.3)
- Blood(3.1)
- Urine(2.7)
- Kidney(2.6)
- Intestine(2.4)
- Heart(2)
Primer Products
-
OriGene qPCR primer pairs and template standards for CYP2D6
-
OriGene qPCR primer pairs for CYP2D6
- genomics-online: primer clones - Search results for available CYP2D6 gene related products
No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for CYP2D6 Gene
Orthologs for CYP2D6 Gene
This gene was present in the common ancestor of animals.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | CYP2D6 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | MGC127055 34 |
|
OneToMany | |
-- 34 |
|
OneToMany | |||
rat (Rattus norvegicus) |
Mammalia | Cyp2d3 33 |
|
||
mouse (Mus musculus) |
Mammalia | Cyp2d22 34 |
|
OneToMany | |
Cyp2d26 34 |
|
OneToMany | |||
Cyp2d40 34 |
|
OneToMany | |||
Cyp2d10 34 |
|
OneToMany | |||
Cyp2d9 34 |
|
OneToMany | |||
Cyp2d34 34 |
|
OneToMany | |||
Cyp2d11 34 |
|
OneToMany | |||
Cyp2d12 34 |
|
OneToMany | |||
oppossum (Monodelphis domestica) |
Mammalia | CYP2D6 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | CYP2D6 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | CYP2D6 33 |
|
||
GGA.10540 34 |
|
OneToOne | |||
lizard (Anolis carolinensis) |
Reptilia | CYP2D6 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | cyp2d6 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | cyp2aa12 34 |
|
ManyToMany | |
cyp2aa11 34 |
|
ManyToMany | |||
cyp2aa7 34 |
|
ManyToMany | |||
cyp2aa2 34 |
|
ManyToMany | |||
cyp2aa1 34 |
|
ManyToMany | |||
cyp2aa3 34 |
|
ManyToMany | |||
cyp2aa4 34 |
|
ManyToMany | |||
cyp2aa8 34 |
|
ManyToMany | |||
cyp2aa9 34 |
|
ManyToMany | |||
fruit fly (Drosophila melanogaster) |
Insecta | Cyp18a1 35 |
|
|
|
Cyp305a1 35 |
|
|
|||
Cyp303a1 35 |
|
|
|||
Cyp307a1 35 |
|
|
|||
worm (Caenorhabditis elegans) |
Secernentea | K09A11.4 35 |
|
|
|
B0304.3 35 |
|
|
|||
C50H11.15 35 |
|
|
|||
K09A11.3 35 |
|
|
|||
Y49C4A.9 35 |
|
|
|||
F41B5.3 35 |
|
|
|||
F41B5.4 35 |
|
|
|||
F44C8.1 35 |
|
|
|||
Y5H2B.6 35 |
|
|
|||
C12D5.7 35 |
|
|
|||
C45H4.2 35 |
|
|
|||
K09A11.2 35 |
|
|
|||
F41B5.7 35 |
|
|
|||
C34B7.3 35 |
|
|
|||
F42A9.5 35 |
|
|
- Species where no ortholog for CYP2D6 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- dog (Canis familiaris)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for CYP2D6 Gene
(32) SIMAP similar genes for CYP2D6 Gene using alignment to 39 proteins:
- CP2D6_HUMAN
- A9QKR9_HUMAN
- C1ID52_HUMAN
- C1ID54_HUMAN
- C4MDQ5_HUMAN
- D0U5L8_HUMAN
- D3IP03_HUMAN
- D3IP04_HUMAN
- D3IP05_HUMAN
- D5KMQ2_HUMAN
- D5KMR1_HUMAN
- D5KMS0_HUMAN
- D5KMU5_HUMAN
- D5KMU6_HUMAN
- D5KMZ1_HUMAN
- D5KN01_HUMAN
- D5KN10_HUMAN
- D5KN50_HUMAN
- D5KN61_HUMAN
- D5KN64_HUMAN
- D5KNB5_HUMAN
- D5KND2_HUMAN
- E7ENE7_HUMAN
- G9CGD2_HUMAN
- H7BY38_HUMAN
- I1VC92_HUMAN
- I1VC93_HUMAN
- Q007T8_HUMAN
- Q007T9_HUMAN
- Q2XND0_HUMAN
- Q2XND2_HUMAN
- Q2XND3_HUMAN
- Q2XND8_HUMAN
- Q38LF9_HUMAN
- Q38LG0_HUMAN
- Q38LG2_HUMAN
- Q3KPF3_HUMAN
- Q6ICD8_HUMAN
- Q6NWU0_HUMAN
Pseudogenes.org Pseudogenes for CYP2D6 Gene
Variants for CYP2D6 Gene
Polymorphic Variants from UniProtKB/Swiss-Prot for CYP2D6 Gene
- CP2D6_HUMAN-P10635
- Genetic variations in CYP2D6 are the cause of poor drug metabolism CYP2D6-related [MIM:608902]. The CYP2D6 gene is highly polymorphic. CYP2D6 activity ranges widely within a population comprising ultrarapid (UM), extensive (EM), intermediate (IM) and poor (PM) metabolizer phenotypes. UM and PM are those most at risk for treatment failure or dose-dependent drug toxicity, respectively. Of the Caucasian populations of Europe and North America, 5%-10% are of the PM phenotype and are unable to metabolize the antihypersensitive drug debrisoquine and numerous other drugs. Different alleles are known, including CYP2D6*1 (PubMed:15768052), CYP2D6*2 (PubMed:25469868), CYP2D6*6B/6C (PubMed:7868129), CYP2D6*7 also known CYP2D6E (PubMed:7845481), CYP2D6*9 also known CYP2D6C (PubMed:1844820), CYP2D6*10 also known CYP2D6J (PubMed:8287064, PubMed:25469868), CYP2D6*12 (PubMed:8655150), CYP2D6*14 (PubMed:10064570), CYP2D6*17 also known CYP2D6Z (PubMed:8971426), CYP2D6*41B (PubMed:15768052), CYP2D6*45A (PubMed:15768052), CYP2D6*45B (PubMed:15768052), CYP2D6*46 (PubMed:15768052), CYP2D6*87 (PubMed:25469868), CYP2D6*88 (PubMed:25469868), CYP2D6*89 (PubMed:25469868), CYP2D6*90 (PubMed:25469868), CYP2D6*91 (PubMed:25469868), CYP2D6*93 (PubMed:25469868), C CYP2D6*94 (PubMed:25469868), CYP2D6*97 (PubMed:25469868) and CYP2D6*98 (PubMed:25469868). Isozymes CYP2D6.45 (Lys-155, Cys-296 and Thr-486) and CYP2D6.46 (His-26, Lys-155, Cys-296 and Thr-486) are functional (PubMed:15768052).
SNP ID | Clin | Chr 22 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1065852 | drug-response, Debrisoquine, poor metabolism of | 42,130,692(-) | G/A | coding_sequence_variant, missense_variant | |
rs1135840 | drug-response, Debrisoquine, ultrarapid metabolism of | 42,126,611(-) | C/G | coding_sequence_variant, genic_downstream_transcript_variant, intron_variant, missense_variant | |
rs16947 | drug-response, Debrisoquine, ultrarapid metabolism of | 42,127,941(-) | G/A/T | coding_sequence_variant, intron_variant, missense_variant | |
rs267608275 | drug-response, not provided | 42,130,049(-) | GGGG/GGG | intron_variant | |
rs267608319 | drug-response, not provided | 42,126,749(-) | C/T | coding_sequence_variant, genic_downstream_transcript_variant, missense_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv1319e212 | CNV | gain | 25503493 |
dgv1320e212 | CNV | loss | 25503493 |
dgv733e201 | CNV | deletion | 23290073 |
dgv841e214 | CNV | gain | 21293372 |
esv2171396 | CNV | deletion | 18987734 |
esv2724275 | CNV | deletion | 23290073 |
esv27312 | CNV | gain+loss | 19812545 |
esv33893 | CNV | gain+loss | 17666407 |
esv3446082 | CNV | duplication | 20981092 |
esv3449611 | CNV | duplication | 20981092 |
esv3568417 | CNV | loss | 25503493 |
esv3575484 | CNV | gain | 25503493 |
esv3647809 | CNV | loss | 21293372 |
esv6632 | CNV | loss | 19470904 |
nsv1076539 | CNV | duplication | 25765185 |
nsv1110402 | CNV | duplication | 24896259 |
nsv1139782 | CNV | duplication | 24896259 |
nsv3641 | CNV | deletion | 18451855 |
nsv3642 | CNV | insertion | 18451855 |
nsv3643 | CNV | insertion | 18451855 |
nsv436350 | CNV | deletion | 17901297 |
nsv498989 | CNV | loss | 21111241 |
nsv508737 | CNV | insertion | 20534489 |
nsv829243 | CNV | loss | 20364138 |
nsv834210 | CNV | loss | 17160897 |
nsv955164 | CNV | deletion | 24416366 |
Additional Variant Information for CYP2D6 Gene
Disorders for CYP2D6 Gene

(38) MalaCards diseases for CYP2D6 Gene - From: HGMD, OMIM, Orphanet, DISEASES, Novoseek, and GeneCards
Disorder | Aliases | PubMed IDs |
---|---|---|
drug metabolism, poor, cyp2d6-related |
|
|
codeine toxicity |
|
|
resistance to tamoxifene |
|
|
antidepressant or antipsychotic toxicity or dose selection |
|
|
multiple chemical sensitivity |
|
|
Genatlas disease for CYP2D6 Gene
Additional Disease Information for CYP2D6
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot for CYP2D6 Gene
Publications for CYP2D6 Gene
- A novel mutant variant of the CYP2D6 gene (CYP2D6*17) common in a black African population: association with diminished debrisoquine hydroxylase activity. (PMID: 8971426) Masimirembwa C … Ingelman-Sundberg M (British journal of clinical pharmacology 1996) 3 4 22 44 58
- A missense mutation in exon 6 of the CYP2D6 gene leading to a histidine 324 to proline exchange is associated with the poor metabolizer phenotype of sparteine. (PMID: 7845481) Evert B … Eichelbaum M (Naunyn-Schmiedeberg's archives of pharmacology 1994) 3 4 22 44 58
- Role of the CYP2D6, EPHX1, MPO, and NQO1 genes in the susceptibility to acute lymphoblastic leukemia in Brazilian children. (PMID: 19593802) Silveira Vda S … Tone LG (Environmental and molecular mutagenesis 2010) 3 22 44 58
- Effects of the serotonin 1A, 2A, 2C, 3A, and 3B and serotonin transporter gene polymorphisms on the occurrence of paroxetine discontinuation syndrome. (PMID: 20075642) Murata Y … Mine K (Journal of clinical psychopharmacology 2010) 3 22 44 58
- Genetic susceptibility factors for multiple chemical sensitivity revisited. (PMID: 20185366) Berg ND … Elberling J (International journal of hygiene and environmental health 2010) 3 22 44 58
Products for CYP2D6 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for CYP2D6
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for CYP2D6
- Search Origene for MassSpec and Protein Over-expression Lysates for CYP2D6
- Origene Custom Protein Services for CYP2D6
- Origene shrna, sirna, and RNAi products in human, mouse, rat for CYP2D6
- Browse OriGene Inhibitory RNA Products For CYP2D6
- OriGene qPCR primer pairs and template standards for CYP2D6
- OriGene qPCR primer pairs for CYP2D6
- OriGene CRISPR knockouts for CYP2D6
- OriGene ORF clones in human for CYP2D6
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CYP2D6
- GenScript: Next-day shipping of latest version cDNA ORF clones for CYP2D6 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for CYP2D6
- GenScript Custom Assay Services for CYP2D6
- GenScript Custom overexpressing Cell Line Services for CYP2D6
- GenScript: Design CRISPR guide RNA sequences for CYP2D6
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for CYP2D6
- Cell Signaling Technology (CST) Antibodies for CYP2D6 (CYP2D6)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for CYP2D6
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for CYP2D6
- Novus Biologicals lysates and proteins for CYP2D6
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for CYP2D6
- Abcam proteins for CYP2D6
- Abcam assays for CYP2D6
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for CYP2D6
- Cloud-Clone Corp. Antibodies for CYP2D6
- Cloud-Clone Corp. Proteins for CYP2D6
- Cloud-Clone Corp. Assay Kits for CYP2D6
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for CYP2D6
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for CYP2D6
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for CYP2D6
- Cyagen custom Knockout/knockin (KOKI) mouse models for CYP2D6
- VectorBuilder custom plasmid, inducible vectors for CYP2D6
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CYP2D6
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for CYP2D6
- antibodies-online: Search results for 132 available CYP2D6 Antibodies ranked by validation data
- Compare Top CYP2D6 Antibodies
- antibodies-online: Search results for 11 available CYP2D6 Elisa Kits ranked by validation data
- Compare Top CYP2D6 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 16 available CYP2D6 Proteins ranked by validation data
- Compare Top CYP2D6 Proteins
- GeneTex CYP2D6 antibody for CYP2D6
- Search GeneTex for Proteins for CYP2D6
- ViGene Biosciences adenoviral particle packaged cDNA for CYP2D6 gene
- ViGene Biosciences lentiviral particle packaged cDNA for CYP2D6 gene
- ViGene Biosciences ready-to-package AAV shRNAs for CYP2D6 gene
- Search ViGene Biosciences for CYP2D6
- Santa Cruz Biotechnology (SCBT) Antibodies for CYP2D6
- Search Santa Cruz Biotechnology (SCBT) for CYP2D6 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for CYP2D6
- Horizon Cell Lines for CYP2D6
- genomics-online: cdna clones - Search results for available CYP2D6 gene related products
- orf clones - Search results for available CYP2D6 gene related products
- genomics-online: gRNA clones - Search results for available CYP2D6 gene related products
- genomics-online: primer clones - Search results for available CYP2D6 gene related products
- genomics-online: shRNA clones - Search results for available CYP2D6 gene related products
Sources for CYP2D6 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5