Free for academic non-profit institutions. Other users need a Commercial license

Aliases for CPE Gene

Aliases for CPE Gene

  • Carboxypeptidase E 2 3 5
  • Enkephalin Convertase 2 3 4
  • Carboxypeptidase H 2 3 4
  • Cobalt-Stimulated Chromaffin Granule Carboxypeptidase 2 3
  • Insulin Granule-Associated Carboxypeptidase 2 3
  • Prohormone-Processing Carboxypeptidase 3 4
  • EC 3.4.17.10 4 61
  • CPH 3 4
  • EC 3.4.17 61

External Ids for CPE Gene

Previous GeneCards Identifiers for CPE Gene

  • GC04P167151
  • GC04P166728
  • GC04P166877
  • GC04P166657
  • GC04P166519
  • GC04P166300
  • GC04P162051

Summaries for CPE Gene

Entrez Gene Summary for CPE Gene

  • This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes. [provided by RefSeq, Nov 2015]

GeneCards Summary for CPE Gene

CPE (Carboxypeptidase E) is a Protein Coding gene. Diseases associated with CPE include Hyperproinsulinemia and Gas Gangrene. Among its related pathways are Allograft rejection and Arf6 trafficking events. GO annotations related to this gene include cell adhesion molecule binding and carboxypeptidase activity. An important paralog of this gene is CPD.

UniProtKB/Swiss-Prot for CPE Gene

  • Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.

Gene Wiki entry for CPE Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CPE Gene

Genomics for CPE Gene

Regulatory Elements for CPE Gene

Enhancers for CPE Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH04G165439 1.5 FANTOM5 Ensembl ENCODE 5.8 +79.2 79189 1.6 PKNOX1 NFIB ZSCAN4 INSM2 ZNF76 KLF17 FEZF1 ZNF2 ZEB1 RFX5 MIR578 HADHAP1 CPE FAM218A GC04M165414 GC04P165491
GH04G165323 1.6 FANTOM5 ENCODE dbSUPER 5.2 -34.1 -34091 8.1 HDGF PKNOX1 FOXA2 MLX CREB3L1 ARNT AGO1 WRNIP1 ARID4B SIN3A KLHL2 TMEM192 NACA3P CPE MSMO1 GC04M165293
GH04G165398 0.5 FANTOM5 14.7 +37.0 37047 0.4 MXI1 RFX1 FOS CPE HADHAP1 MIR578
GH04G165369 1 ENCODE 7.2 +8.9 8917 1.9 FOXA2 MLX ARID4B DMAP1 ZNF48 YY1 SP5 REST MIER2 PPARG CPE KLHL2 GC04P165387
GH04G165476 1 ENCODE 6.6 +115.5 115498 1.2 PKNOX1 ATF1 CREB3L1 ARNT TCF12 ZNF766 CBX5 GATA2 FOS KLF13 CPE GC04P165491 GC04M165414
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around CPE on UCSC Golden Path with GeneCards custom track

Genomic Location for CPE Gene

Chromosome:
4
Start:
165,361,194 bp from pter
End:
165,498,330 bp from pter
Size:
137,137 bases
Orientation:
Plus strand

Genomic View for CPE Gene

Genes around CPE on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CPE Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CPE Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CPE Gene

Proteins for CPE Gene

  • Protein details for CPE Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P16870-CBPE_HUMAN
    Recommended name:
    Carboxypeptidase E
    Protein Accession:
    P16870
    Secondary Accessions:
    • A8K4N1
    • B3KR42
    • B4DFN4
    • D3DP33
    • Q9UIU9

    Protein attributes for CPE Gene

    Size:
    476 amino acids
    Molecular mass:
    53151 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Isoform 2 interacts with HDAC1 and HDAC2.
    SequenceCaution:
    • Sequence=BAG52254.1; Type=Frameshift; Positions=415; Evidence={ECO:0000305};

    Alternative splice isoforms for CPE Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CPE Gene

Selected DME Specific Peptides for CPE Gene

P16870:
  • QIHRGVKGFVRDLQGNPIANAT
  • GDYWRLL
  • FVLSANLHGG
  • DLNRNFPDLDRI
  • IPFVLSA
  • ISFEYHRY
  • ALVSVWLQC
  • KDWFVGRSNAQG
  • AWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLK
  • DLNRNFPD
  • TNGGAWYSVPGGMQDFNYLSSNCFEIT
  • VANYPYD
  • YWEDNKNSLI
  • IFQSLARAYSSFNP
  • GIDHDVTSAKDGDYWRLL
  • TRIHIMPS
  • GNMHGNE
  • NMHGNEAVGRELLI
  • SRIYTVGRSFEGRELLV

Post-translational modifications for CPE Gene

  • Glycosylation at Asn139 and Asn390
  • Modification sites at PhosphoSitePlus

Other Protein References for CPE Gene

Antibody Products

  • R&D Systems Antibodies for CPE (Carboxypeptidase E/CPE)

Domains & Families for CPE Gene

Gene Families for CPE Gene

Suggested Antigen Peptide Sequences for CPE Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P16870

UniProtKB/Swiss-Prot:

CBPE_HUMAN :
  • Belongs to the peptidase M14 family.
Family:
  • Belongs to the peptidase M14 family.
genes like me logo Genes that share domains with CPE: view

Function for CPE Gene

Molecular function for CPE Gene

GENATLAS Biochemistry:
carboxypeptidase E,metallo carboxypeptidase family,regulated secretory pathway sorting receptor,involved in the trimming of paired basic residues at the C terminus of prohormone-derived peptides,mutated in the obese fat mouse
UniProtKB/Swiss-Prot CatalyticActivity:
Release of C-terminal arginine or lysine residues from polypeptides.
UniProtKB/Swiss-Prot Function:
Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.

Enzyme Numbers (IUBMB) for CPE Gene

Gene Ontology (GO) - Molecular Function for CPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004180 carboxypeptidase activity TAS 9019408
GO:0004181 metallocarboxypeptidase activity TAS,IEA --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0008270 zinc ion binding IEA --
genes like me logo Genes that share ontologies with CPE: view
genes like me logo Genes that share phenotypes with CPE: view

Animal Models for CPE Gene

MGI Knock Outs for CPE:
  • Cpe tm1b(EUCOMM)Hmgu
  • Cpe tm1Yplo

Animal Model Products

CRISPR Products

miRNA for CPE Gene

miRTarBase miRNAs that target CPE

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CPE Gene

Localization for CPE Gene

Subcellular locations from UniProtKB/Swiss-Prot for CPE Gene

Isoform 1: Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein. Secreted. Note=Associated with the secretory granule membrane through direct binding to lipid rafts in intragranular conditions. {ECO:0000250 UniProtKB:P15087}.
Isoform 2: Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CPE gene
Compartment Confidence
plasma membrane 5
extracellular 5
golgi apparatus 5
nucleus 4
cytoskeleton 2
endoplasmic reticulum 2
lysosome 2
mitochondrion 1
cytosol 1

Gene Ontology (GO) - Cellular Components for CPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005615 extracellular space IBA,IEA --
GO:0005634 nucleus IEA --
GO:0005794 Golgi apparatus IDA 19166515
GO:0005886 plasma membrane TAS 9019408
genes like me logo Genes that share ontologies with CPE: view

Pathways & Interactions for CPE Gene

genes like me logo Genes that share pathways with CPE: view

Pathways by source for CPE Gene

1 BioSystems pathway for CPE Gene
1 KEGG pathway for CPE Gene

Gene Ontology (GO) - Biological Process for CPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003214 cardiac left ventricle morphogenesis IMP 19593212
GO:0006464 cellular protein modification process NAS 2334405
GO:0006508 proteolysis IEA --
GO:0007218 neuropeptide signaling pathway NAS 2334405
GO:0008152 metabolic process TAS 7663508
genes like me logo Genes that share ontologies with CPE: view

No data available for SIGNOR curated interactions for CPE Gene

Drugs & Compounds for CPE Gene

(16) Drugs for CPE Gene - From: DrugBank, ClinicalTrials, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Insulin Human Approved, Investigational Pharma Target 0
Insulin Pork Approved Pharma Target 0
Colistin Approved Pharma 64
Meropenem Approved, Investigational Pharma 97
Minocycline Approved, Investigational Pharma 231

(8) Additional Compounds for CPE Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with CPE: view

Transcripts for CPE Gene

Unigene Clusters for CPE Gene

Carboxypeptidase E:
Representative Sequences:

Alternative Splicing Database (ASD) splice patterns (SP) for CPE Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3a · 3b ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9a · 9b ^ 10 ^ 11a · 11b ^ 12a · 12b ^ 13a · 13b ^ 14
SP1: - - - -
SP2: - - - - -
SP3: -
SP4: - -
SP5: - - - -
SP6: - -
SP7: -

Relevant External Links for CPE Gene

GeneLoc Exon Structure for
CPE
ECgene alternative splicing isoforms for
CPE

Expression for CPE Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for CPE Gene

mRNA differential expression in normal tissues according to GTEx for CPE Gene

This gene is overexpressed in Brain - Amygdala (x4.5), Brain - Caudate (basal ganglia) (x4.4), and Brain - Nucleus accumbens (basal ganglia) (x4.2).

Protein differential expression in normal tissues from HIPED for CPE Gene

This gene is overexpressed in Islet of Langerhans (17.8), Vitreous humor (14.6), Pancreas (6.7), Cerebrospinal fluid (6.6), and Amniocyte (6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CPE Gene



Protein tissue co-expression partners for CPE Gene

NURSA nuclear receptor signaling pathways regulating expression of CPE Gene:

CPE

SOURCE GeneReport for Unigene cluster for CPE Gene:

Hs.75360

mRNA Expression by UniProt/SwissProt for CPE Gene:

P16870-CBPE_HUMAN
Tissue specificity: Isoform 2, but not isoform 1, is overexpressed in hepatocellular carcinoma (at protein level), as well as in other tumors, including pheochromocytomas and paragangliomas.

Evidence on tissue expression from TISSUES for CPE Gene

  • Nervous system(5)
  • Pancreas(4.8)
  • Eye(4.5)
  • Intestine(4.4)
  • Adrenal gland(3.1)
  • Lung(3.1)
  • Heart(2.5)
  • Kidney(2.5)
  • Muscle(2.5)
  • Thyroid gland(2.5)
  • Liver(2.4)
  • Stomach(2.4)
genes like me logo Genes that share expression patterns with CPE: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for CPE Gene

Orthologs for CPE Gene

This gene was present in the common ancestor of animals.

Orthologs for CPE Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CPE 34 35
  • 99.3 (n)
oppossum
(Monodelphis domestica)
Mammalia CPE 35
  • 92 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia CPE 35
  • 92 (a)
OneToOne
dog
(Canis familiaris)
Mammalia CPE 34 35
  • 90.2 (n)
cow
(Bos Taurus)
Mammalia CPE 34 35
  • 90.18 (n)
rat
(Rattus norvegicus)
Mammalia Cpe 34
  • 88.87 (n)
mouse
(Mus musculus)
Mammalia Cpe 34 16 35
  • 88.66 (n)
chicken
(Gallus gallus)
Aves CPE 34 35
  • 83.74 (n)
lizard
(Anolis carolinensis)
Reptilia CPE 35
  • 93 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia cpe 34
  • 76.45 (n)
Str.15474 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.8836 34
zebrafish
(Danio rerio)
Actinopterygii cpe 34 35
  • 74.08 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG4678 36
  • 41 (a)
worm
(Caenorhabditis elegans)
Secernentea egl-21 34
  • 53.81 (n)
F01D4.4 36
  • 44 (a)
F59A3.1 36
  • 40 (a)
T27A8.1 36
  • 39 (a)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.504 34
Species where no ortholog for CPE was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for CPE Gene

ENSEMBL:
Gene Tree for CPE (if available)
TreeFam:
Gene Tree for CPE (if available)

Paralogs for CPE Gene

Paralogs for CPE Gene

(8) SIMAP similar genes for CPE Gene using alignment to 5 proteins:

genes like me logo Genes that share paralogs with CPE: view

Variants for CPE Gene

Sequence variations from dbSNP and Humsavar for CPE Gene

SNP ID Clin Chr 04 pos Sequence Context AA Info Type
rs541147146 A colorectal cancer sample 165,484,521(+) CAATC(A/G)GCCAC reference, missense
rs1000017131 -- 165,446,739(+) AAGGG(G/T)GGTGT intron-variant
rs10000308 -- 165,398,072(+) AAAAA(A/C)AAAAC intron-variant
rs10000363 -- 165,419,071(+) TCAAA(A/T)AAGCC intron-variant
rs1000042088 -- 165,382,085(+) GGGAG(A/G)ACTGG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for CPE Gene

Variant ID Type Subtype PubMed ID
esv3569803 CNV loss 25503493
esv3569804 CNV loss 25503493
nsv1128107 CNV deletion 24896259
nsv472010 CNV novel sequence insertion 20440878
nsv819783 CNV loss 19587683
nsv822819 CNV loss 20364138
nsv822820 CNV loss 20364138
nsv964109 CNV duplication 23825009

Variation tolerance for CPE Gene

Residual Variation Intolerance Score: 79.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.29; 25.68% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CPE Gene

Human Gene Mutation Database (HGMD)
CPE
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CPE

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CPE Gene

Disorders for CPE Gene

MalaCards: The human disease database

(5) MalaCards diseases for CPE Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hyperproinsulinemia
  • hpri
gas gangrene
  • gas bacillus infection
diabetes mellitus, insulin-dependent
  • diabetes, type 1
phlebotomus fever
  • pappataci fever
obesity
  • obesity, association with
- elite association - COSMIC cancer census association via MalaCards
Search CPE in MalaCards View complete list of genes associated with diseases

Relevant External Links for CPE

Genetic Association Database (GAD)
CPE
Human Genome Epidemiology (HuGE) Navigator
CPE
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CPE
genes like me logo Genes that share disorders with CPE: view

No data available for UniProtKB/Swiss-Prot and Genatlas for CPE Gene

Publications for CPE Gene

  1. Human carboxypeptidase E. Isolation and characterization of the cDNA, sequence conservation, expression and processing in vitro. (PMID: 2334405) Manser E. … Lim L. (Biochem. J. 1990) 2 3 4 22 64
  2. Association of the mutation for the human carboxypeptidase E gene exon 4 with the severity of coronary artery atherosclerosis. (PMID: 18080843) Jia E.Z. … Ma W.Z. (Mol. Biol. Rep. 2009) 3 22 46 64
  3. Molecular scanning of the human carboxypeptidase E gene for mutations in Chinese subjects with coronary atherosclerosis. (PMID: 17957445) Jia E.Z. … Ma W.Z. (Mol. Cell. Biochem. 2008) 3 22 46 64
  4. Association of human carboxypeptidase E exon5 gene polymorphisms with angiographical characteristics of coronary atherosclerosis in a Chinese population. (PMID: 18501121) Wang J. … Jia E.Z. (Acta Pharmacol. Sin. 2008) 3 22 46 64
  5. Organization of the human carboxypeptidase E gene and molecular scanning for mutations in Japanese subjects with NIDDM or obesity. (PMID: 9662053) Utsunomiya N. … Nanjo K. (Diabetologia 1998) 3 4 22 64

Products for CPE Gene

Sources for CPE Gene

Content
Loading form....