Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZRANB1 Gene

Aliases for ZRANB1 Gene

  • Zinc Finger RANBP2-Type Containing 1 2 3 5
  • Zinc Finger Ran-Binding Domain-Containing Protein 1 3 4
  • Zinc Finger, RAN-Binding Domain Containing 1 2 3
  • TRAF-Binding Domain-Containing Protein 3 4
  • HTrabid 3 4
  • TRABID 3 4
  • Ubiquitin Thioesterase ZRANB1 3
  • TRAF-Binding Protein Domain 3
  • EC 3.4.19.12 4
  • EC 3.1.2 58

External Ids for ZRANB1 Gene

Previous GeneCards Identifiers for ZRANB1 Gene

  • GC10P126671
  • GC10P126205
  • GC10P126620
  • GC10P120317

Summaries for ZRANB1 Gene

GeneCards Summary for ZRANB1 Gene

ZRANB1 (Zinc Finger RANBP2-Type Containing 1) is a Protein Coding gene. Among its related pathways are Ovarian tumor domain proteases and Protein ubiquitination. GO annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and K63-linked polyubiquitin binding. An important paralog of this gene is OTUD7A.

UniProtKB/Swiss-Prot for ZRANB1 Gene

  • Specifically hydrolyzes Lys-29-linked and Lys-33-linked diubiquitin. Also cleaves Lys-63-linked chains, but with 40-fold less efficiency compared to Lys-29-linked ones. Positive regulator of the Wnt signaling pathway that deubiquitinates APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.

Additional gene information for ZRANB1 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZRANB1 Gene

Genomics for ZRANB1 Gene

Regulatory Elements for ZRANB1 Gene

Enhancers for ZRANB1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10H124635 1.8 FANTOM5 Ensembl ENCODE dbSUPER 9.1 -277.4 -277368 7 HDGF PKNOX1 RFX5 ZNF766 ELK1 SCRT2 ATF7 IKZF2 SMARCA5 CEBPB FAM53B CHST15 ABRAXAS2 ZRANB1 EEF1AKMT2 GC10M124645 PIR48648 FAM53B-AS1
GH10H124645 1.9 FANTOM5 Ensembl ENCODE dbSUPER 5.3 -265.8 -265782 11 HDGF MLX ARID4B FEZF1 DMAP1 YY1 TCF12 FOS ATF7 RUNX3 FAM53B CHST15 EEF1AKMT2 LHPP ZRANB1 GC10M124645 PIR48648 FAM53B-AS1
GH10H124915 1.1 ENCODE 8.6 +0.8 788 3 FOXA2 MLX ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 ZNF766 ZRANB1 LHPP GC10P124919 ENSG00000226899
GH10H124923 1 Ensembl ENCODE 8.3 +7.6 7599 1 PKNOX1 ZNF146 CEBPB ZMYM3 FEZF1 ZNF384 CEBPG ZNF843 RAD21 OSR2 ENSG00000226899 ZRANB1 GC10P124919
GH10H124970 0.5 ENCODE 16.4 +54.4 54366 1 SCRT1 EED NR2F1 SCRT2 RUNX3 ZRANB1 ENSG00000226899 FAM53B EEF1AKMT2 ENSG00000273599
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ZRANB1 on UCSC Golden Path with GeneCards custom track

Promoters for ZRANB1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000034859 601 2601 FOXA2 MLX ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 ZNF766

Genomic Location for ZRANB1 Gene

Chromosome:
10
Start:
124,916,899 bp from pter
End:
124,988,189 bp from pter
Size:
71,291 bases
Orientation:
Plus strand

Genomic View for ZRANB1 Gene

Genes around ZRANB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZRANB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZRANB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZRANB1 Gene

Proteins for ZRANB1 Gene

  • Protein details for ZRANB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UGI0-ZRAN1_HUMAN
    Recommended name:
    Ubiquitin thioesterase ZRANB1
    Protein Accession:
    Q9UGI0
    Secondary Accessions:
    • B4DZ98
    • D3DRF4
    • Q5SQP6
    • Q69YK3

    Protein attributes for ZRANB1 Gene

    Size:
    708 amino acids
    Molecular mass:
    80967 Da
    Quaternary structure:
    • Interacts with APC and TRAF6.
    SequenceCaution:
    • Sequence=BAG64010.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for ZRANB1 Gene

neXtProt entry for ZRANB1 Gene

Selected DME Specific Peptides for ZRANB1 Gene

Q9UGI0:
  • ENWPSAIKCTMCRA
  • LICPDSSARPRV
  • GIKWACEYCT
  • DFKKLKQI
  • DCSHWFY
  • DWLFLNAC
  • VCPELTEQIRRE
  • LAHILRRPIIVYGVKY
  • SGGDIARQL
  • TDLVTFTLPADIEDLPP
  • KSPIALGYTRGHFSALV
  • DPCEEYNDRN
  • CTYLNWPR
  • TFLPLVDSERKLLH
  • DCCVTEGGVLVAMQKSSRRRNHPLVTQMVEKWLD

Post-translational modifications for ZRANB1 Gene

  • Ubiquitination at isoforms=77
  • Modification sites at PhosphoSitePlus

Other Protein References for ZRANB1 Gene

Antibody Products

  • Abcam antibodies for ZRANB1
  • Santa Cruz Biotechnology (SCBT) Antibodies for ZRANB1

Domains & Families for ZRANB1 Gene

Gene Families for ZRANB1 Gene

Protein Domains for ZRANB1 Gene

Suggested Antigen Peptide Sequences for ZRANB1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9UGI0

UniProtKB/Swiss-Prot:

ZRAN1_HUMAN :
  • The OTU domain mediates the deubiquitinating activity.
  • Belongs to the peptidase C64 family.
Domain:
  • The OTU domain mediates the deubiquitinating activity.
  • The RanBP2-type zinc fingers mediate the specific interaction with Lys-63-linked ubiquitin.
  • The second ankyrin repeat ANK 2 is termed AnkUBD, it interacts with ubiquitin hydrophobic patch and contributes to linkage specificity.
  • The RanBP2-type zinc fingers, also called NZFs, may provide additional ubiquitin-binding sites when hydrolyzing long Lys-63-linked chains.
Family:
  • Belongs to the peptidase C64 family.
genes like me logo Genes that share domains with ZRANB1: view

Function for ZRANB1 Gene

Molecular function for ZRANB1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).
UniProtKB/Swiss-Prot Function:
Specifically hydrolyzes Lys-29-linked and Lys-33-linked diubiquitin. Also cleaves Lys-63-linked chains, but with 40-fold less efficiency compared to Lys-29-linked ones. Positive regulator of the Wnt signaling pathway that deubiquitinates APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.

Enzyme Numbers (IUBMB) for ZRANB1 Gene

Phenotypes From GWAS Catalog for ZRANB1 Gene

Gene Ontology (GO) - Molecular Function for ZRANB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004843 thiol-dependent ubiquitin-specific protease activity IDA 18281465
GO:0005515 protein binding IPI 11463333
GO:0008233 peptidase activity IEA --
GO:0008234 cysteine-type peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with ZRANB1: view
genes like me logo Genes that share phenotypes with ZRANB1: view

Animal Models for ZRANB1 Gene

MGI Knock Outs for ZRANB1:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for ZRANB1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ZRANB1 Gene

Localization for ZRANB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZRANB1 Gene

Cytoplasm. Nucleus. Note=Enriched in punctate localization in the cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZRANB1 gene
Compartment Confidence
nucleus 5
cytosol 5

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ZRANB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA 11463333
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IDA,IEA 11463333
GO:0005829 cytosol TAS --
GO:0043231 intracellular membrane-bounded organelle IDA --
genes like me logo Genes that share ontologies with ZRANB1: view

Pathways & Interactions for ZRANB1 Gene

genes like me logo Genes that share pathways with ZRANB1: view

Pathways by source for ZRANB1 Gene

Gene Ontology (GO) - Biological Process for ZRANB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0007010 cytoskeleton organization IMP 21834987
GO:0016055 Wnt signaling pathway IEA --
GO:0016477 cell migration IMP 21834987
GO:0016579 protein deubiquitination TAS --
genes like me logo Genes that share ontologies with ZRANB1: view

No data available for SIGNOR curated interactions for ZRANB1 Gene

Drugs & Compounds for ZRANB1 Gene

No Compound Related Data Available

Transcripts for ZRANB1 Gene

Unigene Clusters for ZRANB1 Gene

Zinc finger, RAN-binding domain containing 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for ZRANB1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for ZRANB1 Gene

No ASD Table

Relevant External Links for ZRANB1 Gene

GeneLoc Exon Structure for
ZRANB1
ECgene alternative splicing isoforms for
ZRANB1

Expression for ZRANB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZRANB1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ZRANB1 Gene

This gene is overexpressed in Muscle - Skeletal (x4.6).

Protein differential expression in normal tissues from HIPED for ZRANB1 Gene

This gene is overexpressed in Serum (41.2) and Plasma (24.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ZRANB1 Gene



Protein tissue co-expression partners for ZRANB1 Gene

NURSA nuclear receptor signaling pathways regulating expression of ZRANB1 Gene:

ZRANB1

SOURCE GeneReport for Unigene cluster for ZRANB1 Gene:

Hs.595158

mRNA Expression by UniProt/SwissProt for ZRANB1 Gene:

Q9UGI0-ZRAN1_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for ZRANB1 Gene

  • Heart(4.3)
  • Nervous system(2.7)
genes like me logo Genes that share expression patterns with ZRANB1: view

Primer Products

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for ZRANB1 Gene

Orthologs for ZRANB1 Gene

This gene was present in the common ancestor of animals.

Orthologs for ZRANB1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ZRANB1 33 34
  • 99.76 (n)
dog
(Canis familiaris)
Mammalia ZRANB1 33 34
  • 94.28 (n)
rat
(Rattus norvegicus)
Mammalia LOC100360606 33
  • 93.74 (n)
cow
(Bos Taurus)
Mammalia ZRANB1 33 34
  • 93.31 (n)
mouse
(Mus musculus)
Mammalia Zranb1 33 16 34
  • 93.31 (n)
oppossum
(Monodelphis domestica)
Mammalia ZRANB1 34
  • 92 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ZRANB1 34
  • 88 (a)
OneToOne
chicken
(Gallus gallus)
Aves ZRANB1 33 34
  • 85.75 (n)
lizard
(Anolis carolinensis)
Reptilia ZRANB1 34
  • 96 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia zranb1 33
  • 77.78 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.9866 33
zebrafish
(Danio rerio)
Actinopterygii CABZ01057907.1 34
  • 80 (a)
OneToMany
zranb1b 33 34
  • 69.59 (n)
Dr.14548 33
fruit fly
(Drosophila melanogaster)
Insecta trbd 33 34
  • 50.26 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003853 33
  • 49.84 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 48 (a)
OneToOne
Species where no ortholog for ZRANB1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for ZRANB1 Gene

ENSEMBL:
Gene Tree for ZRANB1 (if available)
TreeFam:
Gene Tree for ZRANB1 (if available)

Paralogs for ZRANB1 Gene

Paralogs for ZRANB1 Gene

genes like me logo Genes that share paralogs with ZRANB1: view

Variants for ZRANB1 Gene

Sequence variations from dbSNP and Humsavar for ZRANB1 Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs1000075745 -- 124,971,057(+) GAGCC(A/G)AAGCA intron-variant
rs1000174742 -- 124,926,930(+) GACAC(A/G)TGGTT intron-variant, utr-variant-5-prime
rs1000332555 -- 124,919,512(+) ACTGC(A/C)CTCCA intron-variant
rs1000435770 -- 124,958,403(+) GAGCA(A/G)GGCTC intron-variant
rs1000435955 -- 124,961,707(+) TTAGT(G/T)ACTAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ZRANB1 Gene

Variant ID Type Subtype PubMed ID
nsv552289 CNV loss 21841781

Variation tolerance for ZRANB1 Gene

Residual Variation Intolerance Score: 6.91% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.72; 57.55% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ZRANB1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZRANB1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZRANB1 Gene

Disorders for ZRANB1 Gene

Relevant External Links for ZRANB1

Genetic Association Database (GAD)
ZRANB1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ZRANB1

No disorders were found for ZRANB1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZRANB1 Gene

Publications for ZRANB1 Gene

  1. Isolation and characterization of two novel A20-like proteins. (PMID: 11463333) Evans PC … Kilshaw PJ (The Biochemical journal 2001) 2 3 4 22 60
  2. OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis. (PMID: 23827681) Mevissen TE … Komander D (Cell 2013) 3 4 60
  3. Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration. (PMID: 21834987) Bai SW … Ridley AJ (BMC biology 2011) 3 4 60
  4. An ankyrin-repeat ubiquitin-binding domain determines TRABID's specificity for atypical ubiquitin chains. (PMID: 22157957) Licchesi JD … Komander D (Nature structural & molecular biology 2011) 3 4 60
  5. Trabid, a new positive regulator of Wnt-induced transcription with preference for binding and cleaving K63-linked ubiquitin chains. (PMID: 18281465) Tran H … Bienz M (Genes & development 2008) 3 4 60

Products for ZRANB1 Gene

Sources for ZRANB1 Gene

Content
Loading form....