Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZDHHC9 Gene

Aliases for ZDHHC9 Gene

  • Zinc Finger DHHC-Type Containing 9 2 3 5
  • Zinc Finger Protein 379 3 4
  • Zinc Finger Protein 380 3 4
  • CXorf11 3 4
  • ZDHHC10 3 4
  • ZNF379 3 4
  • ZNF380 3 4
  • DHHC9 3 4
  • Zinc Finger DHHC Domain-Containing Protein 9 4
  • Asp-His-His-Cys Domain Containing Protein 9 3
  • Zinc Finger, DHHC Domain Containing 10 3
  • Zinc Finger, DHHC-Type Containing 10 2
  • Chromosome X Open Reading Frame 11 2
  • Palmitoyltransferase ZDHHC9 3
  • Antigen MMSA-1 3
  • EC 2.3.1.225 4
  • EC 2.3.1.12 61
  • EC 2.3.1 61
  • DHHC-9 4
  • CGI89 3
  • MMSA1 3
  • MRXSZ 3

External Ids for ZDHHC9 Gene

Previous HGNC Symbols for ZDHHC9 Gene

  • ZDHHC10
  • CXorf11

Previous GeneCards Identifiers for ZDHHC9 Gene

  • GC0XM123585
  • GC0XM125785
  • GC0XM126883
  • GC0XM127645
  • GC0XM128664
  • GC0XM128766
  • GC0XM128938
  • GC0XM118338

Summaries for ZDHHC9 Gene

Entrez Gene Summary for ZDHHC9 Gene

  • This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked mental retardation. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, May 2010]

GeneCards Summary for ZDHHC9 Gene

ZDHHC9 (Zinc Finger DHHC-Type Containing 9) is a Protein Coding gene. Diseases associated with ZDHHC9 include Mental Retardation, X-Linked Syndromic, Raymond Type and Lujan-Fryns Syndrome. GO annotations related to this gene include protein-cysteine S-palmitoyltransferase activity and Ras palmitoyltransferase activity. An important paralog of this gene is ZDHHC14.

UniProtKB/Swiss-Prot for ZDHHC9 Gene

  • The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Gene Wiki entry for ZDHHC9 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZDHHC9 Gene

Genomics for ZDHHC9 Gene

Regulatory Elements for ZDHHC9 Gene

Enhancers for ZDHHC9 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH0XG129808 1 FANTOM5 Ensembl dbSUPER 13.3 +35.5 35531 0.6 FOSL1 CEBPB CEBPG HNF4A XPNPEP2 ZDHHC9 ELF4 ENSG00000275070
GH0XG129677 1.1 Ensembl ENCODE 12 +165.7 165692 1.9 CTCF TFAP4 FOXA2 ZSCAN4 MAX SIN3A THRB E2F1 ZFHX2 ZNF316 APLN ZDHHC9 LOC105373334 GC0XM129676
GH0XG129823 0.9 ENCODE dbSUPER 14.2 +20.6 20615 0.2 CTCF ZNF654 TRIM22 REST RAD21 ZFP69B ZNF664 ZNF692 ZNF143 SMC3 ZDHHC9 UTP14A APLN XPNPEP2 ENSG00000275070
GH0XG129748 1.1 Ensembl ENCODE dbSUPER 11.1 +95.3 95334 0.4 JUND NR2F1 HNF4A CEBPG NR2F2 RARA ZDHHC9 XPNPEP2 SASH3
GH0XG129755 1 Ensembl ENCODE dbSUPER 12.2 +87.7 87729 1.4 CTCF RAD51 USF1 SMC3 RAD21 APLN ZDHHC9 XPNPEP2 SASH3
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ZDHHC9 on UCSC Golden Path with GeneCards custom track

Promoters for ZDHHC9 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000248672 434 2200 PKNOX1 ATF1 WRNIP1 ARID4B SIN3A DMAP1 GLIS2 FOS KLF13 SP3

Genomic Location for ZDHHC9 Gene

Chromosome:
X
Start:
129,803,288 bp from pter
End:
129,843,934 bp from pter
Size:
40,647 bases
Orientation:
Minus strand

Genomic View for ZDHHC9 Gene

Genes around ZDHHC9 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC9 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC9 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC9 Gene

Proteins for ZDHHC9 Gene

  • Protein details for ZDHHC9 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9Y397-ZDHC9_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC9
    Protein Accession:
    Q9Y397
    Secondary Accessions:
    • B4F6G2
    • D3DTF9
    • Q59EK4
    • Q5JSW5
    • Q8WWS7
    • Q9BPY4
    • Q9NSP0
    • Q9NVL0
    • Q9NVR6

    Protein attributes for ZDHHC9 Gene

    Size:
    364 amino acids
    Molecular mass:
    40916 Da
    Quaternary structure:
    • Interacts with GOLGA7.
    SequenceCaution:
    • Sequence=AAD34084.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA91683.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAD93044.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAB82308.1; Type=Erroneous initiation; Evidence={ECO:0000305};

neXtProt entry for ZDHHC9 Gene

Selected DME Specific Peptides for ZDHHC9 Gene

Q9Y397:
  • TTNEDIKGSW
  • IEMEIEA
  • NCVERFDHHCPW
  • TLLRTSFSDPGV
  • SFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRI
  • SPAIPVFAAMLFLFSMATLLR
  • RFDHHCPWVG
  • RPPRASHCS
  • VLCGPLPPS

Post-translational modifications for ZDHHC9 Gene

  • Ubiquitination at posLast=127127
  • Modification sites at PhosphoSitePlus

Other Protein References for ZDHHC9 Gene

Domains & Families for ZDHHC9 Gene

Gene Families for ZDHHC9 Gene

Protein Domains for ZDHHC9 Gene

Suggested Antigen Peptide Sequences for ZDHHC9 Gene

Graphical View of Domain Structure for InterPro Entry

Q9Y397

UniProtKB/Swiss-Prot:

ZDHC9_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
Family:
  • Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
genes like me logo Genes that share domains with ZDHHC9: view

Function for ZDHHC9 Gene

Molecular function for ZDHHC9 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
UniProtKB/Swiss-Prot Function:
The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Enzyme Numbers (IUBMB) for ZDHHC9 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 25910212
GO:0008270 zinc ion binding IEA --
GO:0016409 palmitoyltransferase activity IDA 23034182
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
genes like me logo Genes that share ontologies with ZDHHC9: view
genes like me logo Genes that share phenotypes with ZDHHC9: view

Human Phenotype Ontology for ZDHHC9 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

  • Taconic Biosciences Mouse Models for ZDHHC9

CRISPR Products

Inhibitory RNA Products

Clone Products

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for ZDHHC9 Gene

Localization for ZDHHC9 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC9 Gene

Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC9 gene
Compartment Confidence
endoplasmic reticulum 5
cytosol 5
golgi apparatus 5
plasma membrane 3
mitochondrion 1

Gene Ontology (GO) - Cellular Components for ZDHHC9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002178 palmitoyltransferase complex IDA 16000296
GO:0005783 endoplasmic reticulum IEA,IDA 16000296
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0005794 Golgi apparatus IEA,IDA 16647879
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with ZDHHC9: view

Pathways & Interactions for ZDHHC9 Gene

SuperPathways for ZDHHC9 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018230 peptidyl-L-cysteine S-palmitoylation IDA 16000296
GO:0018345 protein palmitoylation IDA 23034182
genes like me logo Genes that share ontologies with ZDHHC9: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC9 Gene

Drugs & Compounds for ZDHHC9 Gene

(1) Drugs for ZDHHC9 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Nutra 0

(1) Additional Compounds for ZDHHC9 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC9: view

Transcripts for ZDHHC9 Gene

Unigene Clusters for ZDHHC9 Gene

Zinc finger, DHHC-type containing 9:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC9 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b · 5c · 5d · 5e ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11 ^ 12 ^ 13
SP1: - - - - -
SP2: - - - - - - - -
SP3: - - -
SP4:
SP5: - - - - -
SP6: - - - -
SP7: - - - -
SP8:
SP9:

Relevant External Links for ZDHHC9 Gene

GeneLoc Exon Structure for
ZDHHC9
ECgene alternative splicing isoforms for
ZDHHC9

Expression for ZDHHC9 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZDHHC9 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ZDHHC9 Gene

This gene is overexpressed in Frontal cortex (69.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ZDHHC9 Gene



Protein tissue co-expression partners for ZDHHC9 Gene

NURSA nuclear receptor signaling pathways regulating expression of ZDHHC9 Gene:

ZDHHC9

SOURCE GeneReport for Unigene cluster for ZDHHC9 Gene:

Hs.193566

mRNA Expression by UniProt/SwissProt for ZDHHC9 Gene:

Q9Y397-ZDHC9_HUMAN
Tissue specificity: Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.

Evidence on tissue expression from TISSUES for ZDHHC9 Gene

  • Nervous system(5)
  • Kidney(4.7)
  • Muscle(4.2)
  • Intestine(2.2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC9 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • endocrine
  • integumentary
  • nervous
  • reproductive
  • respiratory
  • skeletal muscle
  • skeleton
  • urinary
Organs:
Head and neck:
  • brain
  • cheek
  • chin
  • cranial nerve
  • ear
  • eye
  • face
  • forehead
  • head
  • jaw
  • larynx
  • lip
  • mandible
  • maxilla
  • mouth
  • neck
  • nose
  • outer ear
  • pharynx
  • skull
  • tooth
  • vocal cord
Thorax:
  • aorta
  • chest wall
  • heart
  • heart valve
  • lung
  • rib
  • rib cage
  • sternum
Pelvis:
  • pelvis
  • testicle
Limb:
  • ankle
  • digit
  • elbow
  • finger
  • foot
  • hand
  • hip
  • knee
  • lower limb
  • shoulder
  • toe
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • peripheral nervous system
  • skin
  • spinal column
  • vertebrae
genes like me logo Genes that share expression patterns with ZDHHC9: view

Primer Products

No data available for mRNA differential expression in normal tissues for ZDHHC9 Gene

Orthologs for ZDHHC9 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ZDHHC9 Gene

Organism Taxonomy Gene Similarity Type Details
dog
(Canis familiaris)
Mammalia ZDHHC9 34 35
  • 94.78 (n)
cow
(Bos Taurus)
Mammalia ZDHHC9 34 35
  • 94.49 (n)
mouse
(Mus musculus)
Mammalia Zdhhc9 34 16 35
  • 93.41 (n)
rat
(Rattus norvegicus)
Mammalia Zdhhc9 34
  • 92.67 (n)
oppossum
(Monodelphis domestica)
Mammalia ZDHHC9 35
  • 91 (a)
OneToOne
chimpanzee
(Pan troglodytes)
Mammalia ZDHHC9 34
  • 90.15 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC9 35
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves ZDHHC9 34 35
  • 79.04 (n)
lizard
(Anolis carolinensis)
Reptilia ZDHHC9 35
  • 80 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia zdhhc9 34
  • 74.41 (n)
Str.12060 34
zebrafish
(Danio rerio)
Actinopterygii zdhhc9 34 35
  • 71.52 (n)
fruit fly
(Drosophila melanogaster)
Insecta app 35
  • 25 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea Y47H9C.2 36
  • 46 (a)
dhhc-2 35
  • 34 (a)
OneToMany
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0D18370g 34
  • 45.74 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGL125C 34
  • 45.55 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ERF2 34 37
  • 43.18 (n)
rice
(Oryza sativa)
Liliopsida Os11g0534300 34
  • 52.33 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3762 35
  • 50 (a)
OneToMany
bread mold
(Neurospora crassa)
Ascomycetes NCU02015 34
  • 41 (n)
Species where no ortholog for ZDHHC9 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ZDHHC9 Gene

ENSEMBL:
Gene Tree for ZDHHC9 (if available)
TreeFam:
Gene Tree for ZDHHC9 (if available)

Paralogs for ZDHHC9 Gene

Paralogs for ZDHHC9 Gene

(4) SIMAP similar genes for ZDHHC9 Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with ZDHHC9: view

Variants for ZDHHC9 Gene

Sequence variations from dbSNP and Humsavar for ZDHHC9 Gene

SNP ID Clin Chr 0X pos Sequence Context AA Info Type
rs137852214 Pathogenic, Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM:300799] 129,823,724(-) TCTTC(C/T)GGCCT nc-transcript-variant, reference, missense
rs137852215 Pathogenic, Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM:300799] 129,823,718(-) GGCCT(C/T)CCCGG nc-transcript-variant, reference, missense
rs606231182 Pathogenic 129,829,134(-) GGTGC(-/CGCT)ACCTG nc-transcript-variant, reference, frameshift-variant
rs606231183 Pathogenic 129,841,774(-) AGTGA(C/G)TTTCG intron-variant
rs869312679 Uncertain significance 129,810,990(-) GGATC(A/G)AAGGG nc-transcript-variant, reference, missense

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC9 Gene

Variant ID Type Subtype PubMed ID
esv2758893 CNV gain+loss 17122850
esv3577248 CNV gain 25503493
nsv1149298 CNV insertion 26484159
nsv526197 CNV gain 19592680
nsv528290 CNV gain 19592680
nsv7087 CNV deletion 18451855

Variation tolerance for ZDHHC9 Gene

Residual Variation Intolerance Score: 14.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.11; 2.55% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ZDHHC9 Gene

Human Gene Mutation Database (HGMD)
ZDHHC9
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC9

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC9 Gene

Disorders for ZDHHC9 Gene

MalaCards: The human disease database

(5) MalaCards diseases for ZDHHC9 Gene - From: OMIM, ClinVar, GeneTests, Swiss-Prot, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
mental retardation, x-linked syndromic, raymond type
  • syndromic x-linked intellectual disability raymond type
lujan-fryns syndrome
  • x-linked mental retardation with marfanoid habitus
fryns syndrome
  • diaphragmatic hernia, abnormal face, and distal limb anomalies
centrotemporal epilepsy
  • benign rolandic epilepsy
benign epilepsy with centrotemporal spikes
  • centrotemporal epilepsy
- elite association - COSMIC cancer census association via MalaCards

UniProtKB/Swiss-Prot

ZDHC9_HUMAN
  • Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM:300799]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Some MRXSZ patients have marfanoid habitus as an additional feature. {ECO:0000269 PubMed:17436253, ECO:0000269 PubMed:19377476}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Relevant External Links for ZDHHC9

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ZDHHC9
genes like me logo Genes that share disorders with ZDHHC9: view

No data available for Genatlas for ZDHHC9 Gene

Publications for ZDHHC9 Gene

  1. DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras. (PMID: 16000296) Swarthout J.T. … Linder M.E. (J. Biol. Chem. 2005) 3 4 22 64
  2. Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. (PMID: 10810093) Lai C.-H. … Lin W.-C. (Genome Res. 2000) 2 3 4 64
  3. Mutations in ZDHHC9, which encodes a palmitoyltransferase of NRAS and HRAS, cause X-linked mental retardation associated with a Marfanoid habitus. (PMID: 17436253) Raymond F.L. … Futreal P.A. (Am. J. Hum. Genet. 2007) 3 4 64
  4. Differential expression of DHHC9 in microsatellite stable and instable human colorectal cancer subgroups. (PMID: 17519897) Mansilla F. … Orntoft T.F. (Br. J. Cancer 2007) 3 22 64
  5. Serological identification and bioinformatics analysis of immunogenic antigens in multiple myeloma. (PMID: 16193335) Zhou F.L. … Liu S.H. (Cancer Immunol. Immunother. 2006) 3 4 64

Products for ZDHHC9 Gene

Sources for ZDHHC9 Gene

Content
Loading form....