Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZDHHC6 Gene

Aliases for ZDHHC6 Gene

  • Zinc Finger DHHC-Type Containing 6 2 3 5
  • Zinc Finger DHHC Domain-Containing Protein 6 3 4
  • Transmembrane Protein H4 3 4
  • Zinc Finger Protein 376 3 4
  • DHHC-6 3 4
  • ZNF376 3 4
  • Palmitoyltransferase ZDHHC6 3
  • EC 2.3.1.225 4
  • EC 2.3.1 61

External Ids for ZDHHC6 Gene

Previous GeneCards Identifiers for ZDHHC6 Gene

  • GC10M113083
  • GC10M113423
  • GC10M114321
  • GC10M113854
  • GC10M114180
  • GC10M107817

Summaries for ZDHHC6 Gene

GeneCards Summary for ZDHHC6 Gene

ZDHHC6 (Zinc Finger DHHC-Type Containing 6) is a Protein Coding gene. GO annotations related to this gene include protein-cysteine S-palmitoyltransferase activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC7.

UniProtKB/Swiss-Prot for ZDHHC6 Gene

  • Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins.

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZDHHC6 Gene

Genomics for ZDHHC6 Gene

Regulatory Elements for ZDHHC6 Gene

Enhancers for ZDHHC6 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10G112445 1.4 ENCODE dbSUPER 25.7 +0.2 192 2.5 HDGF PKNOX1 ARNT ZFP64 WRNIP1 ARID4B SIN3A ZNF2 YY1 ZNF143 ZDHHC6 ACSL5 VTI1A
GH10G112359 1.4 Ensembl ENCODE dbSUPER 18.1 +83.8 83751 7.5 TBP FOXA2 MLX DMAP1 ZBTB40 RAD21 RARA YY1 GTF3C2 POLR3A ACSL5 ZDHHC6 VTI1A GUCY2GP
GH10G113055 1.9 FANTOM5 Ensembl ENCODE dbSUPER 13.3 -612.6 -612634 9.2 HDGF PKNOX1 FOXA2 CREB3L1 ARNT ARID4B SIN3A FEZF1 ZNF2 YY1 TCF7L2 ZDHHC6 VTI1A LOC105378488 HABP2 RPS15AP30 LOC105378489
GH10G113090 1.9 FANTOM5 Ensembl ENCODE dbSUPER 12.7 -646.9 -646939 6.4 PKNOX1 FOXA2 ATF1 MLX ARID4B FEZF1 TCF12 GTF3C2 ZNF121 GATA2 TCF7L2 ZDHHC6 VTI1A LOC105378488 RPS15AP30 LOC105378489
GH10G112381 2 FANTOM5 Ensembl ENCODE dbSUPER 7 +60.3 60262 10.3 HNRNPUL1 PKNOX1 ATF1 FOXA2 ARNT ZFP64 ARID4B YY1 TCF12 ZNF766 ACSL5 ZDHHC6 VTI1A ENSG00000232934
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ZDHHC6 on UCSC Golden Path with GeneCards custom track

Promoters for ZDHHC6 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000033507 134 2201 HDGF PKNOX1 ARNT ZFP64 WRNIP1 ARID4B SIN3A ZNF2 YY1 ZNF143

Genomic Location for ZDHHC6 Gene

Chromosome:
10
Start:
112,424,428 bp from pter
End:
112,447,234 bp from pter
Size:
22,807 bases
Orientation:
Minus strand

Genomic View for ZDHHC6 Gene

Genes around ZDHHC6 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC6 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC6 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC6 Gene

Proteins for ZDHHC6 Gene

  • Protein details for ZDHHC6 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H6R6-ZDHC6_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC6
    Protein Accession:
    Q9H6R6
    Secondary Accessions:
    • D3DRB6
    • Q53G45
    • Q96IV7
    • Q9H605

    Protein attributes for ZDHHC6 Gene

    Size:
    413 amino acids
    Molecular mass:
    47663 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=BAB15462.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for ZDHHC6 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ZDHHC6 Gene

Selected DME Specific Peptides for ZDHHC6 Gene

Q9H6R6:
  • QNHASFTLFLLLAPLGC
  • FPYDMGS
  • KIILRNKTSIESWIEEKAKDRIQYYQLDEVF
  • MDHHCPW
  • QYSLTIEQLKQKADKRVRSVRYKVIEDY

Post-translational modifications for ZDHHC6 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for ZDHHC6 Gene

Gene Families for ZDHHC6 Gene

Protein Domains for ZDHHC6 Gene

Suggested Antigen Peptide Sequences for ZDHHC6 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9H6R6

UniProtKB/Swiss-Prot:

ZDHC6_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
Family:
  • Belongs to the DHHC palmitoyltransferase family.
genes like me logo Genes that share domains with ZDHHC6: view

Function for ZDHHC6 Gene

Molecular function for ZDHHC6 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
UniProtKB/Swiss-Prot Function:
Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins.

Enzyme Numbers (IUBMB) for ZDHHC6 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008270 zinc ion binding IEA --
GO:0016409 palmitoyltransferase activity IDA 23034182
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0019706 protein-cysteine S-palmitoyltransferase activity IEA --
genes like me logo Genes that share ontologies with ZDHHC6: view
genes like me logo Genes that share phenotypes with ZDHHC6: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ZDHHC6 Gene

Localization for ZDHHC6 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC6 Gene

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC6 gene
Compartment Confidence
endoplasmic reticulum 5
plasma membrane 3
golgi apparatus 1

Gene Ontology (GO) - Cellular Components for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IDA 16647879
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ZDHHC6: view

Pathways & Interactions for ZDHHC6 Gene

SuperPathways for ZDHHC6 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018345 protein palmitoylation IDA 23034182
genes like me logo Genes that share ontologies with ZDHHC6: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC6 Gene

Drugs & Compounds for ZDHHC6 Gene

(1) Drugs for ZDHHC6 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Nutra 0

(1) Additional Compounds for ZDHHC6 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC6: view

Transcripts for ZDHHC6 Gene

Unigene Clusters for ZDHHC6 Gene

Zinc finger, DHHC-type containing 6:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC6 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b ^ 3a · 3b · 3c ^ 4a · 4b ^ 5a · 5b ^ 6a · 6b ^ 7 ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13 ^ 14a · 14b · 14c
SP1: - - - - - -
SP2: - - - - - - -
SP3:
SP4: - - -
SP5:
SP6: -
SP7:
SP8: - -

Relevant External Links for ZDHHC6 Gene

GeneLoc Exon Structure for
ZDHHC6
ECgene alternative splicing isoforms for
ZDHHC6

Expression for ZDHHC6 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZDHHC6 Gene

Protein differential expression in normal tissues from HIPED for ZDHHC6 Gene

This gene is overexpressed in NK cells (20.0), CD8 Tcells (14.1), Retina (11.2), and Placenta (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ZDHHC6 Gene



Protein tissue co-expression partners for ZDHHC6 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of ZDHHC6 Gene:

ZDHHC6

SOURCE GeneReport for Unigene cluster for ZDHHC6 Gene:

Hs.196990

Evidence on tissue expression from TISSUES for ZDHHC6 Gene

  • Muscle(4.2)
  • Nervous system(4)
genes like me logo Genes that share expression patterns with ZDHHC6: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC6 Gene

Orthologs for ZDHHC6 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ZDHHC6 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ZDHHC6 34 35
  • 99.6 (n)
dog
(Canis familiaris)
Mammalia ZDHHC6 34 35
  • 93.14 (n)
cow
(Bos Taurus)
Mammalia ZDHHC6 34 35
  • 92.49 (n)
mouse
(Mus musculus)
Mammalia Zdhhc6 34 16 35
  • 89.02 (n)
oppossum
(Monodelphis domestica)
Mammalia ZDHHC6 35
  • 89 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Zdhhc6 34
  • 88.46 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC6 35
  • 88 (a)
OneToOne
chicken
(Gallus gallus)
Aves ZDHHC6 34 35
  • 78.71 (n)
lizard
(Anolis carolinensis)
Reptilia ZDHHC6 35
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia zdhhc6 34
  • 70.93 (n)
African clawed frog
(Xenopus laevis)
Amphibia MGC52647 34
zebrafish
(Danio rerio)
Actinopterygii zdhhc6 34 35
  • 68.61 (n)
wufa04d12 34
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000886 34
  • 51.48 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG5196 34 35
  • 49.17 (n)
CG4483 35
  • 36 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea M18.8 34
  • 50.84 (n)
dhhc-6 35
  • 33 (a)
OneToOne
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PFA3 35
  • 21 (a)
OneToMany
PFA4 37
thale cress
(Arabidopsis thaliana)
eudicotyledons AT3G09320 34
  • 48.73 (n)
rice
(Oryza sativa)
Liliopsida Os05g0458000 34
  • 46.17 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.1887 34
Species where no ortholog for ZDHHC6 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ZDHHC6 Gene

ENSEMBL:
Gene Tree for ZDHHC6 (if available)
TreeFam:
Gene Tree for ZDHHC6 (if available)

Paralogs for ZDHHC6 Gene

Paralogs for ZDHHC6 Gene

Pseudogenes.org Pseudogenes for ZDHHC6 Gene

genes like me logo Genes that share paralogs with ZDHHC6: view

Variants for ZDHHC6 Gene

Sequence variations from dbSNP and Humsavar for ZDHHC6 Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs1000017846 -- 112,424,036(+) TCTTA(C/T)GAGTT intron-variant, downstream-variant-500B
rs1000033978 -- 112,447,241(+) GTTGA(A/G)AGCTG nc-transcript-variant, upstream-variant-2KB, utr-variant-5-prime
rs1000352319 -- 112,444,770(+) TTATG(A/T)TTTAA intron-variant
rs1000355422 -- 112,427,579(+) TTAAG(C/G)CTTCA intron-variant, utr-variant-3-prime
rs1000384943 -- 112,444,395(+) TCTAC(-/TTTATAG)TTTAG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC6 Gene

Variant ID Type Subtype PubMed ID
esv2741029 CNV deletion 23290073
esv2741040 CNV deletion 23290073
nsv7211 OTHER inversion 18451855
nsv831990 CNV loss 17160897
nsv831991 CNV loss 17160897

Variation tolerance for ZDHHC6 Gene

Residual Variation Intolerance Score: 22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.46; 43.26% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ZDHHC6 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC6

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC6 Gene

Disorders for ZDHHC6 Gene

Relevant External Links for ZDHHC6

Genetic Association Database (GAD)
ZDHHC6
Human Genome Epidemiology (HuGE) Navigator
ZDHHC6
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ZDHHC6

No disorders were found for ZDHHC6 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZDHHC6 Gene

Publications for ZDHHC6 Gene

  1. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  2. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  4. The BioPlex Network: A Systematic Exploration of the Human Interactome. (PMID: 26186194) Huttlin E.L. … Gygi S.P. (Cell 2015) 3 64
  5. Stable expression and function of the inositol 1,4,5-triphosphate receptor requires palmitoylation by a DHHC6/selenoprotein K complex. (PMID: 25368151) Fredericks G.J. … Hoffmann P.R. (Proc. Natl. Acad. Sci. U.S.A. 2014) 3 64

Products for ZDHHC6 Gene

Sources for ZDHHC6 Gene

Content
Loading form....