Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZDHHC16 Gene

Aliases for ZDHHC16 Gene

  • Zinc Finger DHHC-Type Containing 16 2 3 5
  • Zinc Finger DHHC Domain-Containing Protein 16 3 4
  • Abl-Philin 2 3 4
  • DHHC-16 3 4
  • APH2 3 4
  • Zinc Finger, DHHC Domain Containing 16 3
  • Probable Palmitoyltransferase ZDHHC16 3
  • EC 2.3.1.225 4
  • EC 2.3.1 61

External Ids for ZDHHC16 Gene

Previous GeneCards Identifiers for ZDHHC16 Gene

  • GC10P098439
  • GC10P099337
  • GC10P098870
  • GC10P099195
  • GC10P092831

Summaries for ZDHHC16 Gene

GeneCards Summary for ZDHHC16 Gene

ZDHHC16 (Zinc Finger DHHC-Type Containing 16) is a Protein Coding gene. GO annotations related to this gene include protein-cysteine S-palmitoyltransferase activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC6.

UniProtKB/Swiss-Prot for ZDHHC16 Gene

  • May be involved in apoptosis regulation.

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZDHHC16 Gene

Genomics for ZDHHC16 Gene

Regulatory Elements for ZDHHC16 Gene

Enhancers for ZDHHC16 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10G097405 1.9 FANTOM5 Ensembl ENCODE dbSUPER 12.6 -38.6 -38644 3.8 HDGF ATF1 MLX ZFP64 ARID4B SIN3A ZNF2 ZNF48 TCF12 ZNF143 FRAT2 RRP12 FRAT1 ARHGAP19 ZDHHC16 EXOSC1 UBTD1 MMS19 ENSG00000249967 HOGA1
GH10G097412 1.8 FANTOM5 Ensembl ENCODE dbSUPER 12.5 -32.1 -32064 3.1 ELF3 TBP ATF1 CBX3 NFRKB BMI1 RAD21 ZNF121 GATA2 ELK1 RRP12 ZDHHC16 EXOSC1 UBTD1 MMS19 PGAM1 LCOR ZFYVE27 ARHGAP19 FRAT1
GH10G097417 1.4 Ensembl ENCODE dbSUPER 12.6 -26.5 -26527 3.2 HDAC1 ELF3 HDGF TBP PKNOX1 FOXA2 NFRKB KLF17 TCF12 CAVIN1 MARVELD1 RRP12 EXOSC1 ZDHHC16 MMS19 UBTD1 PGAM1 ARHGAP19 GC10M097424 ENSG00000200737
GH10G097494 1.1 Ensembl ENCODE dbSUPER 11.9 +49.3 49269 1.2 ZNF121 MAZ ZNF629 ZBTB33 ZNF394 PRDM1 ZNF652 ZDHHC16 RRP12 SLIT1 MORN4 MMS19
GH10G097411 1 Ensembl dbSUPER 12.5 -34.5 -34531 0.4 GATAD2A SAP130 TEAD1 SP5 NR2F1 CEBPG REST MIER2 RARA TEAD3 ZDHHC16 EXOSC1 UBTD1 MMS19 ENSG00000200737 GC10M097424 ENSG00000231970
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ZDHHC16 on UCSC Golden Path with GeneCards custom track

Genomic Location for ZDHHC16 Gene

Chromosome:
10
Start:
97,446,131 bp from pter
End:
97,457,370 bp from pter
Size:
11,240 bases
Orientation:
Plus strand

Genomic View for ZDHHC16 Gene

Genes around ZDHHC16 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC16 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC16 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC16 Gene

Proteins for ZDHHC16 Gene

  • Protein details for ZDHHC16 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q969W1-ZDH16_HUMAN
    Recommended name:
    Probable palmitoyltransferase ZDHHC16
    Protein Accession:
    Q969W1
    Secondary Accessions:
    • D3DR52
    • D3DR53
    • D3DR54
    • Q5JTG7
    • Q5JTH0
    • Q8N4Z6
    • Q8WY84
    • Q9BSV3

    Protein attributes for ZDHHC16 Gene

    Size:
    377 amino acids
    Molecular mass:
    43633 Da
    Quaternary structure:
    • Interacts with ABL1 (By similarity). Interacts with COPS5/JAB1 (PubMed:17123647).

    Alternative splice isoforms for ZDHHC16 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ZDHHC16 Gene

Selected DME Specific Peptides for ZDHHC16 Gene

Q969W1:
  • SIVAIAYLCVLPLIL
  • GVVFVVLVIVLT
  • TVSICKKCI
  • RLQAKGRVFRN
  • TYSVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGR
  • THKSLVYLWFLCSSVALALGALT
  • MDHHCPW
  • WLNNCVG
  • SLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVC
  • WHAVLISRGETSIERHINKKER
  • CVLKMDHHC
  • YWLVDNVIRW

Post-translational modifications for ZDHHC16 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for ZDHHC16 Gene

Gene Families for ZDHHC16 Gene

Protein Domains for ZDHHC16 Gene

Graphical View of Domain Structure for InterPro Entry

Q969W1

UniProtKB/Swiss-Prot:

ZDH16_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
Family:
  • Belongs to the DHHC palmitoyltransferase family.
genes like me logo Genes that share domains with ZDHHC16: view

Function for ZDHHC16 Gene

Molecular function for ZDHHC16 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
UniProtKB/Swiss-Prot Function:
May be involved in apoptosis regulation.

Enzyme Numbers (IUBMB) for ZDHHC16 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC16 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008270 zinc ion binding IEA --
GO:0016409 palmitoyltransferase activity IDA 23034182
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0019706 protein-cysteine S-palmitoyltransferase activity IEA --
genes like me logo Genes that share ontologies with ZDHHC16: view
genes like me logo Genes that share phenotypes with ZDHHC16: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ZDHHC16 Gene

Localization for ZDHHC16 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC16 Gene

Cytoplasm. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC16 gene
Compartment Confidence
endoplasmic reticulum 4
plasma membrane 3
nucleus 2
lysosome 1
golgi apparatus 1

Gene Ontology (GO) - Cellular Components for ZDHHC16 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ZDHHC16: view

Pathways & Interactions for ZDHHC16 Gene

SuperPathways for ZDHHC16 Gene

No Data Available

Interacting Proteins for ZDHHC16 Gene

Gene Ontology (GO) - Biological Process for ZDHHC16 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006915 apoptotic process IEA --
GO:0018345 protein palmitoylation IDA 23034182
genes like me logo Genes that share ontologies with ZDHHC16: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC16 Gene

Drugs & Compounds for ZDHHC16 Gene

(1) Drugs for ZDHHC16 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Nutra 0

(1) Additional Compounds for ZDHHC16 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC16: view

Transcripts for ZDHHC16 Gene

Unigene Clusters for ZDHHC16 Gene

Zinc finger, DHHC-type containing 16:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC16 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9a · 9b ^ 10 ^ 11 ^ 12a · 12b · 12c ^ 13 ^ 14a · 14b ·
SP1: - - - -
SP2: - - - - -
SP3: - - - - - -
SP4: - - - - - - - -
SP5: - - - - - - - -
SP6: - -
SP7: - - - -
SP8: - -
SP9: - - - - -
SP10: - - -
SP11: -
SP12:

ExUns: 14c
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for ZDHHC16 Gene

GeneLoc Exon Structure for
ZDHHC16
ECgene alternative splicing isoforms for
ZDHHC16

Expression for ZDHHC16 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZDHHC16 Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ZDHHC16 Gene



NURSA nuclear receptor signaling pathways regulating expression of ZDHHC16 Gene:

ZDHHC16

SOURCE GeneReport for Unigene cluster for ZDHHC16 Gene:

Hs.76662

mRNA Expression by UniProt/SwissProt for ZDHHC16 Gene:

Q969W1-ZDH16_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for ZDHHC16 Gene

  • Nervous system(4.6)
genes like me logo Genes that share expression patterns with ZDHHC16: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC16 Gene

Orthologs for ZDHHC16 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ZDHHC16 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ZDHHC16 34 35
  • 99.65 (n)
dog
(Canis familiaris)
Mammalia ZDHHC16 34 35
  • 93.72 (n)
cow
(Bos Taurus)
Mammalia ZDHHC16 34 35
  • 93.02 (n)
mouse
(Mus musculus)
Mammalia Zdhhc16 34 16 35
  • 92.06 (n)
rat
(Rattus norvegicus)
Mammalia Zdhhc16 34
  • 91.32 (n)
oppossum
(Monodelphis domestica)
Mammalia ZDHHC16 35
  • 89 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 27 (a)
ManyToMany
chicken
(Gallus gallus)
Aves ZDHHC16 34 35
  • 75.89 (n)
lizard
(Anolis carolinensis)
Reptilia ZDHHC16 35
  • 67 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia zdhhc16 34
  • 67.25 (n)
Str.19094 34
zebrafish
(Danio rerio)
Actinopterygii zdhhc16b 35
  • 61 (a)
OneToMany
zdhhc16a 34 35
  • 59.56 (n)
zgc63934 34
fruit fly
(Drosophila melanogaster)
Insecta CG5880 34 35
  • 52.09 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP004856 34
  • 49.64 (n)
worm
(Caenorhabditis elegans)
Secernentea C43H6.7 34
  • 42.41 (n)
dhhc-5 35
  • 25 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PFA3 35
  • 18 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 45 (a)
OneToOne
Species where no ortholog for ZDHHC16 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ZDHHC16 Gene

ENSEMBL:
Gene Tree for ZDHHC16 (if available)
TreeFam:
Gene Tree for ZDHHC16 (if available)

Paralogs for ZDHHC16 Gene

Paralogs for ZDHHC16 Gene

genes like me logo Genes that share paralogs with ZDHHC16: view

Variants for ZDHHC16 Gene

Sequence variations from dbSNP and Humsavar for ZDHHC16 Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs1000058773 -- 97,446,901(+) TTTAG(A/T)AGTGA intron-variant, upstream-variant-2KB
rs1000160925 -- 97,450,527(+) TCAGG(G/T)CAAAA intron-variant, nc-transcript-variant, utr-variant-5-prime
rs1000302752 -- 97,455,546(+) GGTGA(A/G)GAAGA intron-variant
rs1000821623 -- 97,450,157(+) TGAGC(C/T)ACCGT intron-variant
rs1001081710 -- 97,457,417(+) GGAAA(C/G)TCAGG downstream-variant-500B

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC16 Gene

Variant ID Type Subtype PubMed ID
nsv1110852 OTHER inversion 24896259

Variation tolerance for ZDHHC16 Gene

Residual Variation Intolerance Score: 19.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.68; 14.41% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ZDHHC16 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC16

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC16 Gene

Disorders for ZDHHC16 Gene

Relevant External Links for ZDHHC16

Genetic Association Database (GAD)
ZDHHC16
Human Genome Epidemiology (HuGE) Navigator
ZDHHC16
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ZDHHC16

No disorders were found for ZDHHC16 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZDHHC16 Gene

Publications for ZDHHC16 Gene

  1. Aph2, a protein with a zf-DHHC motif, interacts with c-Abl and has pro-apoptotic activity. (PMID: 12021275) Li B. … Goff S.P. (J. Biol. Chem. 2002) 2 3 22 64
  2. A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease. (PMID: 16385451) Grupe A. … Goate A. (Am. J. Hum. Genet. 2006) 3 46 64
  3. Molecular cloning and characterization of human Aph2 gene, involved in AP-1 regulation by interaction with JAB1. (PMID: 17123647) Zhang F. … Gu J. (Biochim. Biophys. Acta 2006) 3 4 64
  4. The DNA sequence and comparative analysis of human chromosome 10. (PMID: 15164054) Deloukas P. … Rogers J. (Nature 2004) 3 4 64
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64

Products for ZDHHC16 Gene

Sources for ZDHHC16 Gene

Content
Loading form....