Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZDHHC13 Gene

Aliases for ZDHHC13 Gene

  • Zinc Finger DHHC-Type Containing 13 2 3 5
  • Huntingtin-Interacting Protein 14-Related Protein 3 4
  • Zinc Finger DHHC Domain-Containing Protein 13 3 4
  • Putative NF-Kappa-B-Activating Protein 209 3 4
  • Putative MAPK-Activating Protein PM03 3 4
  • HIP14-Related Protein 3 4
  • DHHC-13 3 4
  • HIP14L 3 4
  • HIP3RP 3 4
  • Zinc Finger, DHHC Domain Containing 13 3
  • Huntingtin Interacting Protein HIP3RP 3
  • Probable Palmitoyltransferase ZDHHC13 3
  • Huntingtin-Interacting Protein HIP3RP 4
  • Palmitoyltransferase ZDHHC13 3
  • EC 2.3.1.225 4
  • EC 2.3.1 61

External Ids for ZDHHC13 Gene

Previous GeneCards Identifiers for ZDHHC13 Gene

  • GC11P019104
  • GC11P018822

Summaries for ZDHHC13 Gene

GeneCards Summary for ZDHHC13 Gene

ZDHHC13 (Zinc Finger DHHC-Type Containing 13) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC17.

UniProtKB/Swiss-Prot for ZDHHC13 Gene

  • Palmitoyltransferase for HD and GAD2. May play a role in Mg(2+) transport.

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZDHHC13 Gene

Genomics for ZDHHC13 Gene

Regulatory Elements for ZDHHC13 Gene

Enhancers for ZDHHC13 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH11G019172 1.3 VISTA dbSUPER 15 +56.7 56665 2.5 PKNOX1 TCF12 ZNF766 CEBPB ZEB2 TFDP1 ZNF589 PBX2 NR2C1 HMBOX1 ZDHHC13 ENSG00000255308 CSRP3 GC11P019191
GH11G019079 1 Ensembl ENCODE 18.4 -36.8 -36810 2.4 JUN MAX GATA3 CTBP1 GATA2 ZNF239 SCRT2 FOSL2 NFE2 RCOR1 ZDHHC13 PTPN5 GC11P019071
GH11G019236 1.6 Ensembl ENCODE dbSUPER 10.7 +123.6 123622 9.1 PKNOX1 ARID4B SIN3A DMAP1 YY1 FOS SP3 SP5 ZHX2 NFYC ZDHHC13 ENSG00000256361 LOC105376580 E2F8 CSRP3
GH11G019216 1.5 VISTA ENCODE dbSUPER 10.1 +101.5 101530 3.6 ATF1 PKNOX1 E2F7 ARID4B SIN3A DMAP1 FOS SP3 SP5 NFYC E2F8 GTF2H1 TSG101 ENSG00000255308 LOC100129966 ENSG00000256588 ZDHHC13 CSRP3
GH11G019071 1.2 Ensembl ENCODE 11 -45.7 -45706 0.5 HDGF PKNOX1 ATF1 ARNT SIN3A BRCA1 ZNF2 YY1 ZNF143 DEK ZDHHC13 MRGPRX2 LOC100420121
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ZDHHC13 on UCSC Golden Path with GeneCards custom track

Promoters for ZDHHC13 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000037670 301 1601 HDGF PKNOX1 SIN3A DMAP1 ZNF48 YY1 GLIS2 ZNF207 FOS SP3

Genomic Location for ZDHHC13 Gene

Chromosome:
11
Start:
19,117,099 bp from pter
End:
19,176,422 bp from pter
Size:
59,324 bases
Orientation:
Plus strand

Genomic View for ZDHHC13 Gene

Genes around ZDHHC13 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC13 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC13 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC13 Gene

Proteins for ZDHHC13 Gene

  • Protein details for ZDHHC13 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8IUH4-ZDH13_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC13
    Protein Accession:
    Q8IUH4
    Secondary Accessions:
    • Q7Z2D3
    • Q86VK2
    • Q9NV30
    • Q9NV99

    Protein attributes for ZDHHC13 Gene

    Size:
    622 amino acids
    Molecular mass:
    70861 Da
    Quaternary structure:
    • Interacts (via ANK repeats) with CLIP3 (PubMed:26198635). Interacts (via ANK repeats) with DNAJC5 (via C-terminus) (By similarity). Interacts (via ANK repeats) with HTT (PubMed:26198635). Interacts (via ANK repeats) with MAP6 (PubMed:26198635). Interacts (via ANK repeats) with SNAP23 (By similarity). Interacts (via ANK repeats) with SNAP25 (By similarity).
    SequenceCaution:
    • Sequence=BAA91856.1; Type=Erroneous termination; Positions=482; Note=Translated as Cys.; Evidence={ECO:0000305};

    Alternative splice isoforms for ZDHHC13 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ZDHHC13 Gene

Selected DME Specific Peptides for ZDHHC13 Gene

Q8IUH4:
  • KCELFLLL
  • LHWAAIN
  • KGETPLDMALQ
  • QNLADFFQCGCFGLVKPC
  • HQNTPLHWAVAAGNV
  • AVDKLLEAGSSLDI
  • DGEGFSSIHLAVLFQHMPIIAYLISK
  • AFLYFFYKTWATDPGFTKASEEE
  • LAETGSLD
  • LPLIEDSSNCDIVKATQYGIFERCKELVEAGYDVRQPD
  • HMKQTLSLRKTPYNLGF
  • FHFSWSTFLL
  • WTGRCIGFGNHH
  • WIIYGSF
  • KVIGPEPTGFLLKFNPSL

Post-translational modifications for ZDHHC13 Gene

  • Ubiquitination at isoforms=80
  • Modification sites at PhosphoSitePlus

Other Protein References for ZDHHC13 Gene

Domains & Families for ZDHHC13 Gene

Suggested Antigen Peptide Sequences for ZDHHC13 Gene

Graphical View of Domain Structure for InterPro Entry

Q8IUH4

UniProtKB/Swiss-Prot:

ZDH13_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
Family:
  • Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
genes like me logo Genes that share domains with ZDHHC13: view

Function for ZDHHC13 Gene

Molecular function for ZDHHC13 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
UniProtKB/Swiss-Prot Function:
Palmitoyltransferase for HD and GAD2. May play a role in Mg(2+) transport.

Enzyme Numbers (IUBMB) for ZDHHC13 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004871 signal transducer activity IMP 12761501
GO:0015095 magnesium ion transmembrane transporter activity ISS --
GO:0016409 palmitoyltransferase activity ISS --
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
genes like me logo Genes that share ontologies with ZDHHC13: view
genes like me logo Genes that share phenotypes with ZDHHC13: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for ZDHHC13 Gene

Localization for ZDHHC13 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC13 Gene

Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Low extracellular Mg(2+) induces increase in Golgi and in post-Golgi vesicles. {ECO:0000250 UniProtKB:Q9CWU2}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC13 gene
Compartment Confidence
endoplasmic reticulum 5
golgi apparatus 5
plasma membrane 3
peroxisome 1

Gene Ontology (GO) - Cellular Components for ZDHHC13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane ISS --
GO:0005783 endoplasmic reticulum IDA 16647879
GO:0005794 Golgi apparatus IEA --
GO:0016020 membrane IEA,IDA 19946888
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ZDHHC13: view

Pathways & Interactions for ZDHHC13 Gene

SuperPathways for ZDHHC13 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0007165 signal transduction IEA --
GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling IMP 12761501
GO:1903830 magnesium ion transmembrane transport IEA --
genes like me logo Genes that share ontologies with ZDHHC13: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC13 Gene

Drugs & Compounds for ZDHHC13 Gene

(1) Drugs for ZDHHC13 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Nutra 0

(1) Additional Compounds for ZDHHC13 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC13: view

Transcripts for ZDHHC13 Gene

Unigene Clusters for ZDHHC13 Gene

Zinc finger, DHHC-type containing 13:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC13 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14a · 14b ^ 15 ^ 16 ^ 17
SP1: -
SP2: - -
SP3: -
SP4:

Relevant External Links for ZDHHC13 Gene

GeneLoc Exon Structure for
ZDHHC13
ECgene alternative splicing isoforms for
ZDHHC13

Expression for ZDHHC13 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZDHHC13 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ZDHHC13 Gene

This gene is overexpressed in Esophagus - Mucosa (x5.1).

Protein differential expression in normal tissues from HIPED for ZDHHC13 Gene

This gene is overexpressed in Nasal epithelium (62.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ZDHHC13 Gene



Protein tissue co-expression partners for ZDHHC13 Gene

NURSA nuclear receptor signaling pathways regulating expression of ZDHHC13 Gene:

ZDHHC13

SOURCE GeneReport for Unigene cluster for ZDHHC13 Gene:

Hs.188569

Evidence on tissue expression from TISSUES for ZDHHC13 Gene

  • Eye(4.1)
  • Lung(4.1)
genes like me logo Genes that share expression patterns with ZDHHC13: view

Primer Products

No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC13 Gene

Orthologs for ZDHHC13 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ZDHHC13 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ZDHHC13 34 35
  • 99.62 (n)
dog
(Canis familiaris)
Mammalia ZDHHC13 34 35
  • 92.02 (n)
cow
(Bos Taurus)
Mammalia ZDHHC13 34 35
  • 91.16 (n)
mouse
(Mus musculus)
Mammalia Zdhhc13 34 16 35
  • 89.92 (n)
rat
(Rattus norvegicus)
Mammalia Zdhhc13 34
  • 88.8 (n)
oppossum
(Monodelphis domestica)
Mammalia ZDHHC13 35
  • 78 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC13 35
  • 77 (a)
OneToOne
chicken
(Gallus gallus)
Aves ZDHHC13 34 35
  • 68.74 (n)
lizard
(Anolis carolinensis)
Reptilia ZDHHC13 35
  • 64 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC100493145 34
  • 62.48 (n)
zebrafish
(Danio rerio)
Actinopterygii zdhhc13 34 35
  • 56.61 (n)
wufi22e09 34
fruit fly
(Drosophila melanogaster)
Insecta Hip14 35
  • 35 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes AKR1 35
  • 20 (a)
ManyToMany
AKR2 35
  • 19 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.11093 35
  • 39 (a)
OneToMany
Species where no ortholog for ZDHHC13 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for ZDHHC13 Gene

ENSEMBL:
Gene Tree for ZDHHC13 (if available)
TreeFam:
Gene Tree for ZDHHC13 (if available)

Paralogs for ZDHHC13 Gene

Paralogs for ZDHHC13 Gene

(1) SIMAP similar genes for ZDHHC13 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with ZDHHC13: view

Variants for ZDHHC13 Gene

Sequence variations from dbSNP and Humsavar for ZDHHC13 Gene

SNP ID Clin Chr 11 pos Sequence Context AA Info Type
rs1000128709 -- 19,142,796(+) ATGGT(A/G)TGATC intron-variant, nc-transcript-variant, reference, missense
rs1000131588 -- 19,138,152(+) AAAAT(A/T)GATAG intron-variant
rs1000241728 -- 19,133,159(+) AGATA(G/T)GTTTA intron-variant
rs1000273436 -- 19,162,376(+) AGTGC(C/T)TTAGA intron-variant
rs1000295298 -- 19,143,877(+) TTAAT(A/C)CATTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC13 Gene

Variant ID Type Subtype PubMed ID
esv2662583 CNV deletion 23128226
esv3428572 CNV insertion 20981092
esv3625530 CNV loss 21293372
esv3625531 CNV loss 21293372
nsv476084 CNV novel sequence insertion 20440878
nsv477679 CNV novel sequence insertion 20440878

Variation tolerance for ZDHHC13 Gene

Residual Variation Intolerance Score: 27.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.13; 51.30% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ZDHHC13 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC13

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC13 Gene

Disorders for ZDHHC13 Gene

Relevant External Links for ZDHHC13

Genetic Association Database (GAD)
ZDHHC13
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ZDHHC13

No disorders were found for ZDHHC13 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZDHHC13 Gene

Publications for ZDHHC13 Gene

  1. Huntingtin-interacting proteins, HIP14 and HIP14L, mediate dual functions, palmitoyl acyltransferase and Mg2+ transport. (PMID: 18794299) Goytain A. … Quamme G.A. (J. Biol. Chem. 2008) 2 3 22 64
  2. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  4. Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways. (PMID: 12761501) Matsuda A. … Sugano S. (Oncogene 2003) 3 4 64
  5. HIP14, a novel ankyrin domain-containing protein, links huntingtin to intracellular trafficking and endocytosis. (PMID: 12393793) Singaraja R.R. … Hayden M.R. (Hum. Mol. Genet. 2002) 3 4 64

Products for ZDHHC13 Gene

Sources for ZDHHC13 Gene

Content
Loading form....