Free for academic non-profit institutions. Other users need a Commercial license

Aliases for USP7 Gene

Aliases for USP7 Gene

  • Ubiquitin Specific Peptidase 7 2 3 5
  • Ubiquitin Specific Peptidase 7 (Herpes Virus-Associated) 2 3
  • Ubiquitin-Specific-Processing Protease 7 3 4
  • Deubiquitinating Enzyme 7 3 4
  • Ubiquitin Thioesterase 7 3 4
  • HAUSP 3 4
  • Ubiquitin Specific Protease 7 (Herpes Virus-Associated) 3
  • Herpes Virus-Associated Ubiquitin-Specific Protease 3
  • Herpesvirus-Associated Ubiquitin-Specific Protease 4
  • Ubiquitin Carboxyl-Terminal Hydrolase 7 3
  • EC 3.4.19.12 4
  • EC 3.1.2.15 61
  • TEF1 3

External Ids for USP7 Gene

Previous HGNC Symbols for USP7 Gene

  • HAUSP

Previous GeneCards Identifiers for USP7 Gene

  • GC16M008792
  • GC16M009087
  • GC16M008953
  • GC16M008954
  • GC16M008894
  • GC16M008985
  • GC16M008907

Summaries for USP7 Gene

Entrez Gene Summary for USP7 Gene

  • The protein encoded by this gene belongs to the peptidase C19 family, which includes ubiquitinyl hydrolases. This protein deubiquitinates target proteins such as p53 (a tumor suppressor protein) and WASH (essential for endosomal protein recycling), and regulates their activities by counteracting the opposing ubiquitin ligase activity of proteins such as HDM2 and TRIM27, involved in the respective process. Mutations in this gene have been implicated in a neurodevelopmental disorder. [provided by RefSeq, Mar 2016]

GeneCards Summary for USP7 Gene

USP7 (Ubiquitin Specific Peptidase 7) is a Protein Coding gene. Diseases associated with USP7 include Uv-Sensitive Syndrome. Among its related pathways are Regulation of TP53 Expression and Degradation and Transcription-Coupled Nucleotide Excision Repair (TC-NER). GO annotations related to this gene include transcription factor binding and protein C-terminus binding. An important paralog of this gene is USP47.

UniProtKB/Swiss-Prot for USP7 Gene

  • Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN and DAXX (PubMed:11923872, PubMed:15053880, PubMed:16964248, PubMed:18716620, PubMed:25283148). Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis (PubMed:25283148). Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection. Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1: acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1 (PubMed:21745816). Exhibits a preference towards Lys-48-linked ubiquitin chains. Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function (PubMed:23973222).

Tocris Summary for USP7 Gene

  • Deubiquitinating enzymes (DUBs) are a group of proteases that catalyze the cleavage of protein-ubiquitin bonds. By removing these modifications, DUBs counteract the activity of ubiquitin ligases, which add ubiquitin molecules to target proteins.

Gene Wiki entry for USP7 Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for USP7 Gene

Genomics for USP7 Gene

Regulatory Elements for USP7 Gene

Enhancers for USP7 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH16F008957 1.5 FANTOM5 ENCODE 11.1 +3.4 3369 7.7 HDGF PKNOX1 MLX ARNT CREB3L1 WRNIP1 ZFP64 ARID4B SIN3A YBX1 USP7 PMM2 LOC105371074 C16orf72 GC16P008959
GH16F008988 0.9 ENCODE 7.4 -24.8 -24763 1.3 ELF3 MLX ARID4B RAD21 RARA THAP11 SP5 MXD4 CEBPB MIER2 USP7 GC16M008994 GC16M008956
GH16F008631 1.5 FANTOM5 Ensembl ENCODE 3.3 +331.8 331754 2.0 ELF3 SOX13 CTCF SAP130 MLX ZMYM3 CEBPG ZNF644 RAD21 ZSCAN9 C16orf72 METTL22 TMEM114 USP7 GC16M008655
GH16F008944 0.7 ENCODE 6.4 +19.7 19679 1.5 PKNOX1 CBX3 MAZ MIER1 MTA2 CBFB HLF MIER2 REST NR3C1 USP7 GC16M008950 PIR37712
GH16F009125 1.6 FANTOM5 Ensembl ENCODE 2.6 -162.9 -162908 3.2 PKNOX1 ATF1 MLX ARID4B SLC30A9 GLIS2 FOS SP5 JUNB MXD4 C16orf72 ENSG00000263244 ENSG00000260349 USP7 GC16P009141 PIR60317
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around USP7 on UCSC Golden Path with GeneCards custom track

Promoters for USP7 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000503286 1214 3000 ARID4B SIN3A DMAP1 YY1 SP5 ZHX2 MXD4 REST KAT8 MAFF

Genomic Location for USP7 Gene

Chromosome:
16
Start:
8,892,094 bp from pter
End:
8,964,514 bp from pter
Size:
72,421 bases
Orientation:
Minus strand

Genomic View for USP7 Gene

Genes around USP7 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
USP7 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for USP7 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for USP7 Gene

Proteins for USP7 Gene

  • Protein details for USP7 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q93009-UBP7_HUMAN
    Recommended name:
    Ubiquitin carboxyl-terminal hydrolase 7
    Protein Accession:
    Q93009
    Secondary Accessions:
    • A6NMY8
    • B7Z815
    • H0Y3G8

    Protein attributes for USP7 Gene

    Size:
    1102 amino acids
    Molecular mass:
    128302 Da
    Quaternary structure:
    • Monomer. Homodimer. Part of a complex with DAXX, MDM2, RASSF1 and USP7 (PubMed:18566590). Part of a complex with DAXX, MDM2 and USP7 (PubMed:16845383). Interacts with MDM2; the interaction is independent of p53/TP53. Interacts with DAXX; the interaction is direct and independent of MDM2 and p53/TP53 (PubMed:16845383). Interacts with FOXO4; the interaction is enhanced in presence of hydrogen peroxide and occurs independently of p53/TP53 (PubMed:16964248). Interacts with p53/TP53; the interaction is enhanced in response to DNA damage (PubMed:25283148). Interacts with TSPYL5; this impairs interaction with p53/TP53 (PubMed:21170034). Interacts with PTEN; the interaction is direct (PubMed:18716620). Interacts with UBXN6 (PubMed:18768758). Interacts with ATXN1 and the strength of interaction is influenced by the length of the poly-Gln region in ATXN1. A weaker interaction seen with mutants having longer poly-Gln regions (PubMed:12093161). Interacts with KIAA1530/UVSSA (PubMed:22466611, PubMed:22466612). Interacts with FAM175B; the interaction is direct (PubMed:25283148). Identified in a complex with TP53/p53 and FAM175B (PubMed:25283148). Isoform 1 and isoform 2 interact with herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 (PubMed:9034339, PubMed:14506283, PubMed:16160161, PubMed:18590780). Interacts with Epstein-Barr virus EBNA1 (PubMed:14506283). EBNA1 shows a 10-fold higher affinity than p53/TP53 and can compete with it for USP7 binding (PubMed:14506283). Binding to ICP0/VMW110 may modulate the substrate specificity or activity of USP7 to stabilize viral proteins. Interacts with MEX3C and antagonizes its ability to degrade mRNA (PubMed:22863774). Interacts with DNMT1 and UHRF1 (PubMed:21745816). Interacts with FOXP3 (PubMed:23973222). Interacts (via MATH domain) with RNF220 (PubMed:25266658).

    Three dimensional structures from OCA and Proteopedia for USP7 Gene

    Alternative splice isoforms for USP7 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for USP7 Gene

Selected DME Specific Peptides for USP7 Gene

Q93009:
  • YPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINY
  • NEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPK
  • RLSESVLSPPCFVRNLPWKIMVMPR
  • EEDMEDDTSWRSEATFQFTVERF
  • HFREVMKRIQ
  • LILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKD
  • ESKLSEV
  • QRVFYELQ
  • YPDKHGCVRDLLEECKK
  • DYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQ
  • GATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCK
  • WDSKKHTG
  • DKVTFEV
  • LTKSFGW
  • ALQRVFY
  • CRVLLDN
  • GEQQLSEPEDMEMEAGD
  • EDYYDIQLSIKGKKNIFESF
  • LHAVLVH
  • DSFMQHD
  • SVPLALQR
  • RVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNT
  • KFDDDVVS
  • SELPTAKEYFRDLY
  • NAYMLVY
  • WLNSQFREEEIT
  • LDIQEKEFEKFKFAIVMMGRH

Post-translational modifications for USP7 Gene

  • Isoform 1 and isoform 2: Not sumoylated.
  • Isoform 1 and isoform 2: Polyubiquitinated by herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110; leading to its subsequent proteasomal degradation. Isoform 1: Ubiquitinated at Lys-869.
  • Isoform 1: Phosphorylated. Isoform 1 is phosphorylated at positions Ser-18 and Ser-963. Isoform 2: Not phosphorylated.
  • Isoform 1: Polyneddylated. Isoform 2: Not Polyneddylated.
  • Ubiquitination at Lys 98, Lys 148, Lys 335, Lys 420, Lys 476, Lys 479, Lys 490, Lys 523, Lys 824, Lys 841, Lys 882, Lys 934, Lys 1033, and Lys 1096
  • Modification sites at PhosphoSitePlus

Domains & Families for USP7 Gene

Gene Families for USP7 Gene

Graphical View of Domain Structure for InterPro Entry

Q93009

UniProtKB/Swiss-Prot:

UBP7_HUMAN :
  • The C-terminus plays a role in its oligomerization.
  • Belongs to the peptidase C19 family.
Domain:
  • The C-terminus plays a role in its oligomerization.
  • Contains 1 MATH domain.
  • Contains 1 USP domain.
Family:
  • Belongs to the peptidase C19 family.
genes like me logo Genes that share domains with USP7: view

Function for USP7 Gene

Molecular function for USP7 Gene

GENATLAS Biochemistry:
ubiquitin-specific protease 7,cellular,135kDa,transitory component of discrete nuclear structures (ND10),binding herpes virus type 1 immediate early protein Vmw 110,stimulating viral gene expression,deubiquitin enzyme family
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
pH dependence: Active from pH 7.0 to 9.5. {ECO:0000269 PubMed:14506283};
UniProtKB/Swiss-Prot CatalyticActivity:
Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by N-ethyl-maleimide (NEM) and divalent cations. Tolerates high concentrations of NaCl but is inhibited at concentrations of 195 mM and higher.
UniProtKB/Swiss-Prot Function:
Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN and DAXX (PubMed:11923872, PubMed:15053880, PubMed:16964248, PubMed:18716620, PubMed:25283148). Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis (PubMed:25283148). Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection. Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1: acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1 (PubMed:21745816). Exhibits a preference towards Lys-48-linked ubiquitin chains. Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function (PubMed:23973222).
UniProtKB/Swiss-Prot Induction:
Up-regulated in regulatory T-cells (Treg).

Enzyme Numbers (IUBMB) for USP7 Gene

Gene Ontology (GO) - Molecular Function for USP7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002039 p53 binding IDA 20096447
GO:0004197 cysteine-type endopeptidase activity IMP,TAS 21745816
GO:0004843 thiol-dependent ubiquitin-specific protease activity TAS --
GO:0005515 protein binding IPI 11279055
GO:0008022 protein C-terminus binding IPI 12093161
genes like me logo Genes that share ontologies with USP7: view
genes like me logo Genes that share phenotypes with USP7: view

Animal Models for USP7 Gene

MGI Knock Outs for USP7:

Animal Model Products

  • Taconic Biosciences Mouse Models for USP7

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for USP7

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for USP7 Gene

Localization for USP7 Gene

Subcellular locations from UniProtKB/Swiss-Prot for USP7 Gene

Nucleus. Cytoplasm. Nucleus, PML body. Note=Present in a minority of ND10 nuclear bodies. Association with ICP0/VMW110 at early times of infection leads to an increased proportion of USP7-containing ND10. Colocalizes with ATXN1 in the nucleus. Colocalized with DAXX in speckled structures. Colocalized with PML and PTEN in promyelocytic leukemia protein (PML) nuclear bodies.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for USP7 gene
Compartment Confidence
nucleus 5
cytosol 5
golgi apparatus 2
mitochondrion 1

Gene Ontology (GO) - Cellular Components for USP7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA,TAS 11279055
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol IDA 11279055
GO:0016604 nuclear body IDA 16791210
genes like me logo Genes that share ontologies with USP7: view

Pathways & Interactions for USP7 Gene

genes like me logo Genes that share pathways with USP7: view

SIGNOR curated interactions for USP7 Gene

Activates:

Gene Ontology (GO) - Biological Process for USP7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006281 DNA repair IEA --
GO:0006283 transcription-coupled nucleotide-excision repair TAS --
GO:0006508 proteolysis IEA --
GO:0006511 ubiquitin-dependent protein catabolic process IEA --
GO:0006974 cellular response to DNA damage stimulus IEA --
genes like me logo Genes that share ontologies with USP7: view

Drugs & Compounds for USP7 Gene

(12) Drugs for USP7 Gene - From: ApexBio, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
HBX 41108 Pharma Selective USP7 inhibitor 0
DUBs-IN-1 Pharma 0
DUBs-IN-2 Pharma deubiquitinase enzyme inhibitor 0
NSC 632839 hydrochloride Pharma Isopeptidases inhibitor 0

(5) Tocris Compounds for USP7 Gene

Compound Action Cas Number
HBX 41108 Selective USP7 inhibitor 924296-39-9
IU1 USP14 inhibitor 314245-33-5
LDN 57444 Ubiquitin C-terminal hydrolase-L1 (UCH-L1) inhibitor 668467-91-2
PR 619 Broad spectrum DUB inhibitor 2645-32-1
Spautin 1 USP10 and USP13 inhibitor; inhibits autophagy 1262888-28-7

(7) ApexBio Compounds for USP7 Gene

Compound Action Cas Number
DUBs-IN-1 924296-18-4
DUBs-IN-2 deubiquitinase enzyme inhibitor 924296-19-5
HBX 41108 924296-39-9
NSC 632839 hydrochloride Isopeptidases inhibitor 157654-67-6
P 22077 USP7/(DUB)USP47 inhibitor 1247819-59-5
P005091 Ubiquitin-specific protease 7 (USP7) inhibitor 882257-11-6
USP7-USP47 inhibitor USP7/USP47 inhibitor 1247825-37-1
genes like me logo Genes that share compounds with USP7: view

Transcripts for USP7 Gene

Unigene Clusters for USP7 Gene

Ubiquitin specific peptidase 7 (herpes virus-associated):
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for USP7

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for USP7 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17a · 17b ^ 18a · 18b ^ 19 ^ 20a · 20b · 20c ^ 21a ·
SP1: - - -
SP2: - - - -
SP3:
SP4:
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:

ExUns: 21b ^ 22a · 22b ^ 23 ^ 24a · 24b ^ 25a · 25b · 25c · 25d ^ 26a · 26b ^ 27 ^ 28a · 28b ^ 29 ^ 30 ^ 31a · 31b ^ 32 ^ 33 ^ 34a · 34b
SP1: - - - - - -
SP2: - - - - - -
SP3:
SP4:
SP5:
SP6: - -
SP7:
SP8: -
SP9: -
SP10: - -

Relevant External Links for USP7 Gene

GeneLoc Exon Structure for
USP7
ECgene alternative splicing isoforms for
USP7

Expression for USP7 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for USP7 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for USP7 Gene

This gene is overexpressed in Lymph node (9.8) and Peripheral blood mononuclear cells (8.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for USP7 Gene



Protein tissue co-expression partners for USP7 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of USP7 Gene:

USP7

SOURCE GeneReport for Unigene cluster for USP7 Gene:

Hs.386939

mRNA Expression by UniProt/SwissProt for USP7 Gene:

Q93009-UBP7_HUMAN
Tissue specificity: Widely expressed. Overexpressed in prostate cancer.
genes like me logo Genes that share expression patterns with USP7: view

Primer Products

No data available for mRNA differential expression in normal tissues for USP7 Gene

Orthologs for USP7 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for USP7 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia USP7 34 35
  • 99.76 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia USP7 35
  • 98 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Usp7 34 16 35
  • 92.56 (n)
oppossum
(Monodelphis domestica)
Mammalia USP7 35
  • 92 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Usp7 34
  • 91.77 (n)
dog
(Canis familiaris)
Mammalia USP7 34 35
  • 91.58 (n)
cow
(Bos Taurus)
Mammalia USP7 34 35
  • 90.65 (n)
chicken
(Gallus gallus)
Aves USP7 34 35
  • 85.95 (n)
lizard
(Anolis carolinensis)
Reptilia USP7 35
  • 91 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia usp7 34
  • 82.49 (n)
Str.80 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.29048 34
zebrafish
(Danio rerio)
Actinopterygii usp7 34 35
  • 79.53 (n)
Dr.17905 34
fruit fly
(Drosophila melanogaster)
Insecta Usp7 34 35
  • 55.02 (n)
Ubp64E 36
  • 38 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008530 34
  • 53.6 (n)
worm
(Caenorhabditis elegans)
Secernentea math-33 34 35
  • 48.03 (n)
H19N07.2a 36
  • 33 (a)
H19N07.2b 36
  • 33 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes UBP15 34 35 37
  • 48.83 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGL357W 34
  • 48.07 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons UBP13 34
  • 49.25 (n)
rice
(Oryza sativa)
Liliopsida Os12g0489100 34
  • 54.09 (n)
Os.2185 34
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 52 (a)
OneToOne
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes ubp15 34
  • 47.77 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU03797 34
  • 47.75 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4025 34
Species where no ortholog for USP7 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for USP7 Gene

ENSEMBL:
Gene Tree for USP7 (if available)
TreeFam:
Gene Tree for USP7 (if available)

Paralogs for USP7 Gene

Paralogs for USP7 Gene

Pseudogenes.org Pseudogenes for USP7 Gene

genes like me logo Genes that share paralogs with USP7: view

Variants for USP7 Gene

Sequence variations from dbSNP and Humsavar for USP7 Gene

SNP ID Clin Chr 16 pos Sequence Context AA Info Type
rs756550597 Uncertain significance 8,921,250(+) TCTCT(A/G)TAATT nc-transcript-variant, reference, synonymous-codon
rs10163394 -- 8,914,974(+) agaca(C/T)ctaaa intron-variant
rs10500365 -- 8,909,117(+) TTCTA(C/T)GGGGA intron-variant
rs10500366 -- 8,955,253(+) TTCTA(C/T)ATGAT intron-variant
rs1050394 -- 8,893,721(-) GAGAA(A/G)AGGTT nc-transcript-variant, utr-variant-3-prime

Structural Variations from Database of Genomic Variants (DGV) for USP7 Gene

Variant ID Type Subtype PubMed ID
dgv2725n100 CNV gain 25217958
dgv2726n100 CNV gain 25217958
esv1715688 CNV insertion 17803354
esv26318 CNV loss 19812545
esv2665907 CNV deletion 23128226
esv27013 CNV gain 19812545
esv2763129 CNV gain 21179565
esv2763130 CNV gain 21179565
esv3310492 CNV novel sequence insertion 20981092
esv3451644 CNV insertion 20981092
esv3637851 CNV loss 21293372
esv3637852 CNV gain 21293372
esv3637854 CNV gain 21293372
esv3637855 CNV loss 21293372
esv3637856 CNV gain 21293372
esv987802 CNV insertion 20482838
nsv1040937 CNV gain 25217958
nsv1043528 CNV gain 25217958
nsv1070743 CNV deletion 25765185
nsv1112683 CNV deletion 24896259
nsv1126414 CNV deletion 24896259
nsv457394 CNV gain 19166990
nsv457399 CNV loss 19166990
nsv571424 CNV gain 21841781
nsv571429 CNV loss 21841781
nsv827548 CNV gain 20364138
nsv827549 CNV gain 20364138
nsv833135 CNV loss 17160897
nsv952917 CNV deletion 24416366

Variation tolerance for USP7 Gene

Residual Variation Intolerance Score: 1.77% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.66; 14.14% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for USP7 Gene

Human Gene Mutation Database (HGMD)
USP7
SNPedia medical, phenotypic, and genealogical associations of SNPs for
USP7

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for USP7 Gene

Disorders for USP7 Gene

MalaCards: The human disease database

(1) MalaCards diseases for USP7 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
uv-sensitive syndrome
  • uv sensitive syndrome
- elite association - COSMIC cancer census association via MalaCards
Search USP7 in MalaCards View complete list of genes associated with diseases

Relevant External Links for USP7

Genetic Association Database (GAD)
USP7
Human Genome Epidemiology (HuGE) Navigator
USP7
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
USP7
genes like me logo Genes that share disorders with USP7: view

No data available for UniProtKB/Swiss-Prot and Genatlas for USP7 Gene

Publications for USP7 Gene

  1. The tumour suppressor RASSF1A promotes MDM2 self-ubiquitination by disrupting the MDM2-DAXX-HAUSP complex. (PMID: 18566590) Song M.S. … Lim D.S. (EMBO J. 2008) 3 4 22 64
  2. The deubiquitinylation and localization of PTEN are regulated by a HAUSP-PML network. (PMID: 18716620) Song M.S. … Pandolfi P.P. (Nature 2008) 3 4 22 64
  3. Biochemical characterization of USP7 reveals post-translational modification sites and structural requirements for substrate processing and subcellular localization. (PMID: 17651432) Fernandez-Montalvan A. … Gerhartz B. (FEBS J. 2007) 3 4 22 64
  4. Structural basis of competitive recognition of p53 and MDM2 by HAUSP/USP7: implications for the regulation of the p53-MDM2 pathway. (PMID: 16402859) Hu M. … Shi Y. (PLoS Biol. 2006) 3 4 22 64
  5. Molecular recognition of p53 and MDM2 by USP7/HAUSP. (PMID: 16474402) Sheng Y. … Frappier L. (Nat. Struct. Mol. Biol. 2006) 3 4 22 64

Products for USP7 Gene

Sources for USP7 Gene

Content
Loading form....