Free for academic non-profit institutions. Other users need a Commercial license

Aliases for UGDH Gene

Aliases for UGDH Gene

  • UDP-Glucose 6-Dehydrogenase 2 3 5
  • UDP-Glucose Dehydrogenase 2 3
  • UDP-Glc Dehydrogenase 3 4
  • EC 1.1.1.22 4 61
  • UDP-GlcDH 3 4
  • UDPGDH 3 4
  • Uridine Diphospho-Glucose Dehydrogenase 3
  • GDH 3
  • UGD 3

External Ids for UGDH Gene

Previous GeneCards Identifiers for UGDH Gene

  • GC04M039674
  • GC04M039335
  • GC04M039397
  • GC04M039322
  • GC04M039176
  • GC04M038825

Summaries for UGDH Gene

Entrez Gene Summary for UGDH Gene

  • The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

GeneCards Summary for UGDH Gene

UGDH (UDP-Glucose 6-Dehydrogenase) is a Protein Coding gene. Among its related pathways are Porphyrin and chlorophyll metabolism and Amino sugar and nucleotide sugar metabolism. GO annotations related to this gene include electron carrier activity and oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor.

UniProtKB/Swiss-Prot for UGDH Gene

  • Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.

Gene Wiki entry for UGDH Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UGDH Gene

Genomics for UGDH Gene

Regulatory Elements for UGDH Gene

Enhancers for UGDH Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH04G039525 1.1 ENCODE 6.9 +0.5 547 4.1 HDGF PKNOX1 FOXA2 CREB3L1 MLX WRNIP1 ZFP64 ARID4B SIN3A DMAP1 LOC105374419 SMIM14 UGDH-AS1 UGDH RPL9 GC04M039495
GH04G039514 1.3 Ensembl ENCODE 5.6 +13.1 13100 1.8 HNRNPUL1 FOXA2 MLX ARID4B SIN3A FEZF1 DMAP1 YY1 FOS ZNF263 SMIM14 LOC105374419 UGDH-AS1 LOC401127 UGDH RPL9 GC04M039495
GH04G039520 1.1 Ensembl ENCODE 5.1 +5.3 5284 4.6 FOXA2 SIN3A ZNF48 YY1 RARA ZNF335 RELB KLF11 GATAD2B SSRP1 RPL9 LOC105374419 SMIM14 UGDH-AS1 UGDH GC04M039495
GH04G039501 0.7 FANTOM5 ENCODE 6 +25.8 25752 2.3 JUND FOS MAFK RPL9 UGDH GC04M039495 LOC401127
GH04G039538 0.9 ENCODE 0.4 -13.7 -13668 7.3 PKNOX1 FOXA2 SIN3A FEZF1 BMI1 ZNF121 EGR1 ZNF366 SCRT2 FOS RPL9 RNU7-11P LOC105374419 SMIM14 UGDH-AS1 GC04M039547 UGDH
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around UGDH on UCSC Golden Path with GeneCards custom track

Promoters for UGDH Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000167632 910 3200 HDGF PKNOX1 FOXA2 CREB3L1 MLX WRNIP1 ZFP64 ARID4B SIN3A DMAP1

Genomic Location for UGDH Gene

Chromosome:
4
Start:
39,498,755 bp from pter
End:
39,528,311 bp from pter
Size:
29,557 bases
Orientation:
Minus strand

Genomic View for UGDH Gene

Genes around UGDH on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UGDH Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UGDH Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UGDH Gene

Proteins for UGDH Gene

  • Protein details for UGDH Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O60701-UGDH_HUMAN
    Recommended name:
    UDP-glucose 6-dehydrogenase
    Protein Accession:
    O60701
    Secondary Accessions:
    • B3KUU2
    • B4DN25
    • O60589

    Protein attributes for UGDH Gene

    Size:
    494 amino acids
    Molecular mass:
    55024 Da
    Quaternary structure:
    • Homohexamer.

    Three dimensional structures from OCA and Proteopedia for UGDH Gene

    Alternative splice isoforms for UGDH Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for UGDH Gene

Selected DME Specific Peptides for UGDH Gene

O60701:
  • EKSTVPV
  • KPAFIFDGR
  • YWQQVIDMN
  • LSNPEFLAEGTAI
  • LFNTVTDKKIAI
  • PIYEPGL
  • TTNTWSSELSKL
  • DRVLIGG
  • QVSRLVTIS
  • IGFQIETIGKKVS
  • TGADVEEVATAIGMDQRIGNKFLKASVGFGG
  • GKGRAADLKY
  • CRGKNLFFST
  • ELSKLAANAFLAQRISS
  • RINAWNS
  • EIKKICCIGAGYVGGPTCSVIA
  • SVGFGGSCFQKD
  • LHIYDPKVP

Post-translational modifications for UGDH Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

Domains & Families for UGDH Gene

Graphical View of Domain Structure for InterPro Entry

O60701

UniProtKB/Swiss-Prot:

UGDH_HUMAN :
  • Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
Family:
  • Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
genes like me logo Genes that share domains with UGDH: view

No data available for Gene Families for UGDH Gene

Function for UGDH Gene

Molecular function for UGDH Gene

GENATLAS Biochemistry:
UDP-glucose dehydrogenase,converting UDP-glucose to UDP-glucuronate,involved in normal cell proliferation and migration,upregulated by androgens,playing a potentially important role in the control of sex steroid inactivation via glucuronidation in breast cancer cells
UniProtKB/Swiss-Prot CatalyticActivity:
UDP-glucose + 2 NAD(+) + H(2)O = UDP-glucuronate + 2 NADH.
UniProtKB/Swiss-Prot EnzymeRegulation:
UDP-alpha-D-xylose (UDX) acts as a feedback inhibitor by activating an allosteric switch.
UniProtKB/Swiss-Prot Function:
Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.

Enzyme Numbers (IUBMB) for UGDH Gene

Gene Ontology (GO) - Molecular Function for UGDH Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0003979 UDP-glucose 6-dehydrogenase activity TAS --
GO:0009055 electron carrier activity TAS 9737970
GO:0016491 oxidoreductase activity IEA --
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor IEA --
genes like me logo Genes that share ontologies with UGDH: view
genes like me logo Genes that share phenotypes with UGDH: view

Animal Model Products

  • Taconic Biosciences Mouse Models for UGDH

CRISPR Products

miRNA for UGDH Gene

miRTarBase miRNAs that target UGDH

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for UGDH
  • Applied Biological Materials Clones for UGDH

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for UGDH Gene

Localization for UGDH Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UGDH gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 5
peroxisome 1

Gene Ontology (GO) - Cellular Components for UGDH Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005654 nucleoplasm IDA --
GO:0005829 cytosol TAS --
GO:0070062 extracellular exosome IDA 23533145
genes like me logo Genes that share ontologies with UGDH: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for UGDH Gene

Pathways & Interactions for UGDH Gene

genes like me logo Genes that share pathways with UGDH: view

UniProtKB/Swiss-Prot O60701-UGDH_HUMAN

  • Pathway: Nucleotide-sugar biosynthesis; UDP-alpha-D-glucuronate biosynthesis; UDP-alpha-D-glucuronate from UDP-alpha-D-glucose: step 1/1.

Gene Ontology (GO) - Biological Process for UGDH Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001702 gastrulation with mouth forming second IEA --
GO:0006011 UDP-glucose metabolic process TAS 9737970
GO:0006024 glycosaminoglycan biosynthetic process TAS 9737970
GO:0006065 UDP-glucuronate biosynthetic process TAS --
GO:0008152 metabolic process IEA --
genes like me logo Genes that share ontologies with UGDH: view

No data available for SIGNOR curated interactions for UGDH Gene

Drugs & Compounds for UGDH Gene

(12) Drugs for UGDH Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
UDP-alpha-D-glucuronic acid Experimental Pharma 0
Uridine diphosphate glucose Experimental Pharma 0
NADH Nutra Target 0
NAD Pharma Full agonist, Agonist 0

(16) Additional Compounds for UGDH Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Hydrogen Ion
  • Hydrogen cation
  • Hydron
  • Proton
genes like me logo Genes that share compounds with UGDH: view

Transcripts for UGDH Gene

Unigene Clusters for UGDH Gene

UDP-glucose 6-dehydrogenase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for UGDH
  • Applied Biological Materials Clones for UGDH

Alternative Splicing Database (ASD) splice patterns (SP) for UGDH Gene

ExUns: 1a · 1b · 1c · 1d · 1e ^ 2a · 2b ^ 3a · 3b ^ 4a · 4b · 4c ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9
SP1:
SP2: - - -
SP3:
SP4: -
SP5: - - -
SP6: - - - -
SP7: - - -
SP8: - -

Relevant External Links for UGDH Gene

GeneLoc Exon Structure for
UGDH
ECgene alternative splicing isoforms for
UGDH

Expression for UGDH Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for UGDH Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for UGDH Gene

This gene is overexpressed in Liver (x6.4).

Protein differential expression in normal tissues from HIPED for UGDH Gene

This gene is overexpressed in Bone marrow stromal cell (19.2), Liver (6.3), and Islet of Langerhans (6.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for UGDH Gene



Protein tissue co-expression partners for UGDH Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of UGDH Gene:

UGDH

SOURCE GeneReport for Unigene cluster for UGDH Gene:

Hs.572518

mRNA Expression by UniProt/SwissProt for UGDH Gene:

O60701-UGDH_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for UGDH Gene

  • Liver(4.7)
  • Skin(4.5)
  • Nervous system(3.1)
  • Intestine(2.4)
  • Kidney(2.4)
  • Stomach(2.1)
genes like me logo Genes that share expression patterns with UGDH: view

Primer Products

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for UGDH Gene

Orthologs for UGDH Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for UGDH Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia UGDH 34 35
  • 99.8 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 35
  • 97 (a)
OneToMany
-- 35
  • 97 (a)
OneToMany
platypus
(Ornithorhynchus anatinus)
Mammalia UGDH 35
  • 97 (a)
OneToOne
dog
(Canis familiaris)
Mammalia UGDH 34 35
  • 93.99 (n)
cow
(Bos Taurus)
Mammalia UGDH 34 35
  • 93.45 (n)
mouse
(Mus musculus)
Mammalia Ugdh 34 16 35
  • 89.86 (n)
rat
(Rattus norvegicus)
Mammalia Ugdh 34
  • 89.79 (n)
chicken
(Gallus gallus)
Aves UGDH 34 35
  • 82.25 (n)
lizard
(Anolis carolinensis)
Reptilia UGDH 35
  • 90 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ugdh 34
  • 78 (n)
Str.1204 34
African clawed frog
(Xenopus laevis)
Amphibia MGC52511 34
zebrafish
(Danio rerio)
Actinopterygii ugdh 34 35
  • 73.81 (n)
fruit fly
(Drosophila melanogaster)
Insecta sgl 36 34 35
  • 61.28 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006532 34
  • 61.17 (n)
worm
(Caenorhabditis elegans)
Secernentea sqv-4 34 35
  • 61.63 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons AT5G39320 34
  • 60.45 (n)
soybean
(Glycine max)
eudicotyledons Gma.6350 34
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.8544 34
rice
(Oryza sativa)
Liliopsida Os03g0604200 34
  • 54.92 (n)
Os.10473 34
barley
(Hordeum vulgare)
Liliopsida Hv.12401 34
wheat
(Triticum aestivum)
Liliopsida Ta.2657 34
corn
(Zea mays)
Liliopsida Zm.4986 34
sea squirt
(Ciona savignyi)
Ascidiacea CSA.8331 35
  • 68 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.748 34
Species where no ortholog for UGDH was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for UGDH Gene

ENSEMBL:
Gene Tree for UGDH (if available)
TreeFam:
Gene Tree for UGDH (if available)

Paralogs for UGDH Gene

(2) SIMAP similar genes for UGDH Gene using alignment to 8 proteins:

genes like me logo Genes that share paralogs with UGDH: view

No data available for Paralogs for UGDH Gene

Variants for UGDH Gene

Sequence variations from dbSNP and Humsavar for UGDH Gene

SNP ID Clin Chr 04 pos Sequence Context AA Info Type
rs1000084236 -- 39,502,551(+) CTGGC(A/G)TATTT intron-variant
rs10001159 -- 39,519,608(+) atctc(A/G)gctca intron-variant
rs10004662 -- 39,504,233(+) AACCC(A/G)GGAGG intron-variant
rs1000521950 -- 39,528,058(+) CTCCT(C/T)GCCCA nc-transcript-variant, upstream-variant-2KB
rs1000567123 -- 39,498,547(+) GTAAC(A/C)ACCAT downstream-variant-500B

Structural Variations from Database of Genomic Variants (DGV) for UGDH Gene

Variant ID Type Subtype PubMed ID
nsv1010189 CNV gain 25217958
nsv1010784 CNV gain 25217958

Variation tolerance for UGDH Gene

Residual Variation Intolerance Score: 37.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.92; 35.74% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for UGDH Gene

Human Gene Mutation Database (HGMD)
UGDH
SNPedia medical, phenotypic, and genealogical associations of SNPs for
UGDH

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UGDH Gene

Disorders for UGDH Gene

Relevant External Links for UGDH

Genetic Association Database (GAD)
UGDH
Human Genome Epidemiology (HuGE) Navigator
UGDH
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
UGDH

No disorders were found for UGDH Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for UGDH Gene

Publications for UGDH Gene

  1. Molecular cloning and characterization of the human and mouse UDP- glucose dehydrogenase genes. (PMID: 9737970) Spicer A.P. … Seldin M.F. (J. Biol. Chem. 1998) 2 3 4 22 64
  2. Assignment of the UGDH locus encoding UDP-glucose dehydrogenase to human chromosome band 4p15.1 by radiation hybrid mapping. (PMID: 10575217) Marcu O. … Marsh J.L. (Cytogenet. Cell Genet. 1999) 2 3 22 64
  3. cDNA cloning and expression analysis of the human UDPglucose dehydrogenase. (PMID: 9850599) Peng H.L. … Chang H.Y. (Proc. Natl. Sci. Counc. Repub. China, B, Life Sci. 1998) 3 4 22 64
  4. Structural and kinetic evidence that catalytic reaction of human UDP- glucose 6-dehydrogenase involves covalent thiohemiacetal and thioester enzyme intermediates. (PMID: 22123821) Egger S. … Nidetzky B. (J. Biol. Chem. 2012) 3 4 64
  5. Structure and mechanism of human UDP-glucose 6-dehydrogenase. (PMID: 21502315) Egger S. … Nidetzky B. (J. Biol. Chem. 2011) 3 4 64

Products for UGDH Gene

  • Addgene plasmids for UGDH

Sources for UGDH Gene

Content
Loading form....