Free for academic non-profit institutions. Other users need a Commercial license

Aliases for UBE2Z Gene

Aliases for UBE2Z Gene

  • Ubiquitin Conjugating Enzyme E2 Z 2 3 5
  • Uba6-Specific E2 Conjugating Enzyme 1 3 4
  • E2 Ubiquitin-Conjugating Enzyme Z 3 4
  • Ubiquitin Carrier Protein Z 3 4
  • Ubiquitin-Protein Ligase Z 3 4
  • UBA6-Specific Enzyme E2 2 3
  • USE1 3 4
  • Ubiquitin-Conjugating Enzyme E2 Z 3
  • Ubiquitin-Conjugating Enzyme E2Z 2
  • Ubiquitin Conjugating Enzyme E2Z 3
  • EC 6.3.2.19 61
  • EC 2.3.2.23 4
  • HOYS7 3

External Ids for UBE2Z Gene

Previous GeneCards Identifiers for UBE2Z Gene

  • GC17P044341
  • GC17P046985
  • GC17P042357

Summaries for UBE2Z Gene

Entrez Gene Summary for UBE2Z Gene

  • This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012]

GeneCards Summary for UBE2Z Gene

UBE2Z (Ubiquitin Conjugating Enzyme E2 Z) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin protein ligase activity. An important paralog of this gene is BIRC6.

UniProtKB/Swiss-Prot for UBE2Z Gene

  • Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UBE2Z Gene

Genomics for UBE2Z Gene

Regulatory Elements for UBE2Z Gene

Enhancers for UBE2Z Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17G048906 1.4 ENCODE dbSUPER 18.4 +0.4 442 4.4 MLX CREB3L1 AGO1 ZFP64 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 UBE2Z ATP5G1 ENSG00000230532 SNF8 RNU1-42P HOXB4 ENSG00000266601 NFE2L1 SUMO2P17
GH17G048869 1.3 Ensembl ENCODE 19.2 -36.7 -36664 5.1 FOXA2 PKNOX1 MLX ARID4B SIN3A DMAP1 YY1 SLC30A9 ZNF143 FOS ATP5G1 TTLL6 CALCOCO2 UBE2Z HOXB13 PRAC1 PRAC2 SUMO2P17 LOC105371811 ENSG00000238804
GH17G048914 1.3 Ensembl ENCODE dbSUPER 18.3 +7.2 7157 3.0 HDGF SIN3A YBX1 EBF1 ZBTB40 RELA ZNF335 ZNF121 ARID3A EED UBE2Z SNF8 RNU1-42P ENSG00000238804 ATP5G1 TTLL6 PRAC1 PRAC2 NFE2L1 SUMO2P17
GH17G048891 1.2 ENCODE 18.1 -14.9 -14944 4.2 CREB3L1 ZFP64 DMAP1 YY1 ZNF143 ZNF263 SP3 NFYC TBX21 ZFP41 ATP5G1 ENSG00000266601 UBE2Z ENSG00000262837 ENSG00000264701 FLJ45513 LOC100419622
GH17G048970 1.7 FANTOM5 Ensembl ENCODE 12.7 +63.9 63944 3.7 HDGF FOXA2 MLX ZFP64 ARID4B SIN3A DMAP1 ZNF548 FOS DEK SUMO2P17 UBE2Z ENSG00000262837 ENSG00000230532 TTLL6 PHOSPHO1 IGF2BP1 SNF8 GIP
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around UBE2Z on UCSC Golden Path with GeneCards custom track

Promoters for UBE2Z Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000095409 431 2001 MLX CREB3L1 AGO1 ZFP64 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3

Genomic Location for UBE2Z Gene

Chromosome:
17
Start:
48,908,369 bp from pter
End:
48,929,060 bp from pter
Size:
20,692 bases
Orientation:
Plus strand

Genomic View for UBE2Z Gene

Genes around UBE2Z on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2Z Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2Z Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2Z Gene

Proteins for UBE2Z Gene

  • Protein details for UBE2Z Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H832-UBE2Z_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 Z
    Protein Accession:
    Q9H832
    Secondary Accessions:
    • A6N8M6
    • A6NC60
    • Q7L354
    • Q8TCM4
    • Q9H893

    Protein attributes for UBE2Z Gene

    Size:
    354 amino acids
    Molecular mass:
    38210 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH15890.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAB14724.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for UBE2Z Gene

    Alternative splice isoforms for UBE2Z Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for UBE2Z Gene

Selected DME Specific Peptides for UBE2Z Gene

Q9H832:
  • MQDPFGEKRGHFDYQSLL
  • GDSKNYNECIRHETIRVAVC
  • SSVLISIQSLMTENPYHNEPGFEQERH
  • FRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLS

Post-translational modifications for UBE2Z Gene

  • Ubiquitination at Lys166
  • Modification sites at PhosphoSitePlus

Other Protein References for UBE2Z Gene

Domains & Families for UBE2Z Gene

Gene Families for UBE2Z Gene

Protein Domains for UBE2Z Gene

Suggested Antigen Peptide Sequences for UBE2Z Gene

Graphical View of Domain Structure for InterPro Entry

Q9H832

UniProtKB/Swiss-Prot:

UBE2Z_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2Z: view

Function for UBE2Z Gene

Molecular function for UBE2Z Gene

UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
UniProtKB/Swiss-Prot Function:
Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.

Enzyme Numbers (IUBMB) for UBE2Z Gene

Gene Ontology (GO) - Molecular Function for UBE2Z Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 16189514
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
GO:0031625 ubiquitin protein ligase binding IBA --
GO:0061630 ubiquitin protein ligase activity IBA --
genes like me logo Genes that share ontologies with UBE2Z: view
genes like me logo Genes that share phenotypes with UBE2Z: view

Animal Model Products

CRISPR Products

miRNA for UBE2Z Gene

miRTarBase miRNAs that target UBE2Z

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for UBE2Z Gene

Localization for UBE2Z Gene

Subcellular locations from UniProtKB/Swiss-Prot for UBE2Z Gene

Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2Z gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 1
extracellular 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for UBE2Z Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IBA,IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with UBE2Z: view

Pathways & Interactions for UBE2Z Gene

genes like me logo Genes that share pathways with UBE2Z: view

Pathways by source for UBE2Z Gene

UniProtKB/Swiss-Prot Q9H832-UBE2Z_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2Z Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006915 apoptotic process IEA --
GO:0016567 protein ubiquitination TAS --
GO:0042787 protein ubiquitination involved in ubiquitin-dependent protein catabolic process IEA --
genes like me logo Genes that share ontologies with UBE2Z: view

No data available for SIGNOR curated interactions for UBE2Z Gene

Drugs & Compounds for UBE2Z Gene

(3) Drugs for UBE2Z Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved Nutra 0
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for UBE2Z Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with UBE2Z: view

Transcripts for UBE2Z Gene

Unigene Clusters for UBE2Z Gene

Ubiquitin-conjugating enzyme E2Z:
Representative Sequences:

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2Z Gene

ExUns: 1 ^ 2a · 2b · 2c ^ 3a · 3b ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7a · 7b
SP1: - - - -
SP2: - - -
SP3: -
SP4:
SP5: - -

Relevant External Links for UBE2Z Gene

GeneLoc Exon Structure for
UBE2Z
ECgene alternative splicing isoforms for
UBE2Z

Expression for UBE2Z Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for UBE2Z Gene

Protein differential expression in normal tissues from HIPED for UBE2Z Gene

This gene is overexpressed in Uterus (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for UBE2Z Gene



Protein tissue co-expression partners for UBE2Z Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of UBE2Z Gene:

UBE2Z

SOURCE GeneReport for Unigene cluster for UBE2Z Gene:

Hs.514297

mRNA Expression by UniProt/SwissProt for UBE2Z Gene:

Q9H832-UBE2Z_HUMAN
Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis.

Evidence on tissue expression from TISSUES for UBE2Z Gene

  • Nervous system(4.8)
  • Skin(4.4)
  • Thyroid gland(4.3)
  • Pancreas(4.2)
  • Lung(2.4)
genes like me logo Genes that share expression patterns with UBE2Z: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2Z Gene

Orthologs for UBE2Z Gene

This gene was present in the common ancestor of chordates.

Orthologs for UBE2Z Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia UBE2Z 34 35
  • 99.19 (n)
dog
(Canis familiaris)
Mammalia UBE2Z 35
  • 99 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia UBE2Z 35
  • 97 (a)
OneToOne
cow
(Bos Taurus)
Mammalia UBE2Z 34 35
  • 95.57 (n)
rat
(Rattus norvegicus)
Mammalia Ube2z 34
  • 93.31 (n)
mouse
(Mus musculus)
Mammalia Ube2z 34 16 35
  • 93.22 (n)
oppossum
(Monodelphis domestica)
Mammalia UBE2Z 35
  • 92 (a)
OneToOne
chicken
(Gallus gallus)
Aves UBE2Z 34 35
  • 82.28 (n)
lizard
(Anolis carolinensis)
Reptilia UBE2Z 35
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ube2z 34
  • 76.75 (n)
Str.10246 34
African clawed frog
(Xenopus laevis)
Amphibia MGC69155 34
zebrafish
(Danio rerio)
Actinopterygii ube2z 34 35
  • 72.94 (n)
Dr.28857 34
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8725 34
Species where no ortholog for UBE2Z was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for UBE2Z Gene

ENSEMBL:
Gene Tree for UBE2Z (if available)
TreeFam:
Gene Tree for UBE2Z (if available)

Paralogs for UBE2Z Gene

Paralogs for UBE2Z Gene

genes like me logo Genes that share paralogs with UBE2Z: view

Variants for UBE2Z Gene

Sequence variations from dbSNP and Humsavar for UBE2Z Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs1000135803 -- 48,906,459(+) CTGCG(C/T)GACAA intron-variant, upstream-variant-2KB
rs1000246447 -- 48,912,619(+) TGAGT(A/G)AGATG intron-variant
rs1000331721 -- 48,924,231(+) CCAAA(C/G/T)TGGGA intron-variant
rs1000521090 -- 48,908,228(+) TCTCC(A/G)CTACT intron-variant, upstream-variant-2KB
rs1000555858 -- 48,920,939(+) TAGGC(C/T)AAATG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for UBE2Z Gene

Variant ID Type Subtype PubMed ID
esv3640729 CNV loss 21293372
nsv1112711 CNV deletion 24896259
nsv2073 CNV insertion 18451855
nsv482969 CNV loss 15286789
nsv833472 CNV gain 17160897

Variation tolerance for UBE2Z Gene

Residual Variation Intolerance Score: 33% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.05; 1.03% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for UBE2Z Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2Z

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2Z Gene

Disorders for UBE2Z Gene

Relevant External Links for UBE2Z

Genetic Association Database (GAD)
UBE2Z
Human Genome Epidemiology (HuGE) Navigator
UBE2Z
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
UBE2Z

No disorders were found for UBE2Z Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for UBE2Z Gene

Publications for UBE2Z Gene

  1. Dual E1 activation systems for ubiquitin differentially regulate E2 enzyme charging. (PMID: 17597759) Jin J. … Harper J.W. (Nature 2007) 2 3 4 64
  2. Cloning and characterization of a gene encoding the human putative ubiquitin conjugating enzyme E2Z (UBE2Z). (PMID: 17160626) Gu X. … Mao Y. (Mol. Biol. Rep. 2007) 3 4 22 64
  3. Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease. (PMID: 21378990) Schunkert H. … Samani N.J. (Nat. Genet. 2011) 3 46 64
  4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64

Products for UBE2Z Gene

Sources for UBE2Z Gene

Content
Loading form....