Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

UBE2Z Gene

protein-coding   GIFtS: 59
GCID: GC17P046985

ubiquitin-conjugating enzyme E2Z

 Explore 1 disease affiliated with
UBE2Z via our new
 Human Malady Compendium 
Biological research products
for UBE2Z
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Ubiquitin-Conjugating Enzyme E2Z1 2     EC 6.3.2.193 8
USE11 2     FLJ138551
Uba6-Specific E2 Conjugating Enzyme 12 3     UBA6-Specific Enzyme E22
Ubiquitin Carrier Protein Z2 3     Ubiquitin-Conjugating Enzyme E2 Z2
Ubiquitin-Protein Ligase Z2 3     Use13

External Ids:    HGNC: 258471   Entrez Gene: 652642   Ensembl: ENSG000001592027   OMIM: 6113625   UniProtKB: Q9H8323   

Export aliases for UBE2Z gene to outside databases

Previous GC identifers: GC17P044341 GC17P042357


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for UBE2Z:
This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.
(provided by RefSeq, Feb 2012)

UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
Function: Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for
UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000017.10  NC_018928.1  NT_010783.15  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the UBE2Z gene promoter:
         GR   Pax-5   Bach2   RREB-1   Evi-1   PPAR-alpha   HSF2   Chx10   ARP-1   Ik-1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidUBE2Z promoter sequence
   Search SABiosciences Chromatin IP Primers for UBE2Z

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat UBE2Z


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 17q21.32   Ensembl cytogenetic band:  17q21.32   HGNC cytogenetic band: 17q21.32

UBE2Z Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
UBE2Z gene location

GeneLoc information about chromosome 17         GeneLoc Exon Structure

GeneLoc location for GC17P046985:  view genomic region     (about GC identifiers)

Start:
46,985,731 bp from pter      End:
47,006,422 bp from pter
Size:
20,692 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832 (See protein sequence)
Recommended Name: Ubiquitin-conjugating enzyme E2 Z  
Size: 354 amino acids; 38210 Da
Subcellular location: Cytoplasm. Nucleus
Sequence caution: Sequence=AAH15890.1; Type=Erroneous initiation; Sequence=BAB14724.1; Type=Erroneous initiation;
Secondary accessions: A6N8M6 A6NC60 Q7L354 Q8TCM4 Q9H893
Alternative splicing: 2 isoforms:  Q9H832-1   Q9H832-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for UBE2Z: NX_Q9H832

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_Q9H832

  • 4 DME Specific Peptides for UBE2Z (Q9H832)
     MQDPFGEKRGHFDYQSLL  GDSKNYNECIRHETIRVAVC  SSVLISIQSLMTENPYHNEPGFEQERH  FRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLS 

    UBE2Z Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_075567.2  
    ENSEMBL proteins: 
     ENSP00000354201   ENSP00000424543   ENSP00000425398   ENSP00000461147   ENSP00000460759  
     ENSP00000459473  
    Reactome Protein details: Q9H832
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    R&D Systems Recombinant & Natural Proteins for UBE2Z (Use1/UBE2Z)
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate: UBE2Z
    OriGene Custom Protein Services for UBE2Z 
    GenScript Custom Purified and Recombinant Proteins Services for UBE2Z
    Novus Biologicals UBE2Z Proteins
    Novus Biologicals UBE2Z Lysates
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for UBE2Z

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005634nucleus IDA--
    GO:0005730NOT nucleolus IDA--
    GO:0005737cytoplasm IDA--


    UBE2Z for ontologies           About GeneDecksing



    UBE2Z Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for UBE2Z 
    GenScript Custom Superior Antibodies Services for UBE2Z
    Novus Biologicals UBE2Z Antibodies
    Search for Antibodies for UBE2Z at Abcam  
    Uscn Antibodies for UBE2Z
    Search ThermoFisher Antibodies for UBE2Z

    Assay Products for UBE2Z: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for UBE2Z
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for UBE2Z


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    UBE2Z for domains           About GeneDecksing

    2 InterPro domains/families:
     IPR016135 UBQ-conjugating_enzyme/RWD
     IPR000608 UBQ-conjugat_E2

    Graphical View of Domain Structure for InterPro Entry Q9H832

    ProtoNet protein and cluster: Q9H832

    1 Blocks protein family: IPB000608 Ubiquitin-conjugating enzymes

    UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Similarity: Belongs to the ubiquitin-conjugating enzyme family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Function: Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for
    UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation
    Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine

    Enzyme Number (IUBMB): EC 6.3.2.191 2

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: UBE2Z
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat UBE2Z
    8/54 QIAGEN miScript miRNA Assays for microRNAs that regulate UBE2Z (see all 54):
    hsa-miR-579 hsa-miR-142-5p hsa-miR-4291 hsa-miR-607 hsa-miR-25 hsa-miR-200a hsa-miR-219-5p hsa-miR-764
    SwitchGear 3'UTR luciferase reporter plasmidUBE2Z 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for UBE2Z (see all 7)
    OriGene shRNA RFP: UBE2Z
    OriGene siRNA: UBE2Z
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2Z

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for UBE2Z

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2Z (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2Z (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: UBE2Z (NM_023079)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2Z
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2Z 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for UBE2Z
    Search LifeMap BioReagents cell lines for UBE2Z

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2Z

    Gene Ontology (GO): 3 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004842ubiquitin-protein ligase activity IEA--
    GO:0005524ATP binding IEA--
    GO:0016881acid-amino acid ligase activity ----


    UBE2Z for ontologies           About GeneDecksing


    3 GenomeRNAi human phenotypes for UBE2Z:
     Increased cell death HMECs cel  Synthetic lethal with Ras  Wnt reporter downregulated 


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways  About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Antigen processing: Ubiquitination & Proteasome degradation
    Antigen processing: Ubiquitination & Proteasome degradation1.00
    Polyubiquitination of substrate0.75
    Class I MHC mediated antigen processing & presentation0.83
    Ubiquitin mediated proteolysis0.36
    2Immune System
    Immune System1.00
    Adaptive Immune System0.59

    Pathway sources
    See GeneCards unified pathways
    Show all pathways


    5        Reactome Pathways for UBE2Z
        Antigen processing: Ubiquitination & Proteasome degradation
    Polyubiquitination of substrate
    Adaptive Immune System
    Class I MHC mediated antigen processing & presentation
    Immune System


    1         Kegg Pathway  (Kegg details for UBE2Z):
        Ubiquitin mediated proteolysis

    UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Pathway: Protein modification; protein ubiquitination


    UBE2Z for pathways           About GeneDecksing

    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for UBE2Z

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/43 Interacting proteins for UBE2Z (Q9H8322, 3 ENSP000003542014) via UniProtKB, MINT, STRING, and/or I2D (see all 43)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    PLEKHF2Q9H8W42, 3, ENSP000003223734MINT-67937 I2D: score=5 STRING: ENSP00000322373
    LPLP068582, 3MINT-63417 I2D: score=5 
    HLTFQ145273, ENSP000003089444I2D: score=2 STRING: ENSP00000308944
    LNX2Q8N4483, ENSP000003259294I2D: score=2 STRING: ENSP00000325929
    MDM2Q009873, ENSP000004172814I2D: score=2 STRING: ENSP00000417281
    About this table

    Gene Ontology (GO): 1 biological process term (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006915apoptotic process IEA--


    UBE2Z for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for UBE2Z

    4 HMDB Compounds for UBE2Z    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosine monophosphate5'-AMP (see all 28)61-19-8--
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--
    Search CenterWatch for drugs/clinical trials and news about UBE2Z 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for UBE2Z gene: 
    NM_023079.4  

    Unigene Cluster for UBE2Z:

    Ubiquitin-conjugating enzyme E2Z
    Hs.514297  [show with all ESTs]
    Unigene Representative Sequence: AK091644
    8 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000360943(uc002ioi.3) ENST00000508468 ENST00000506498 ENST00000511373
    ENST00000504684 ENST00000513342 ENST00000506271 ENST00000514948

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: UBE2Z
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat UBE2Z
    8/54 QIAGEN miScript miRNA Assays for microRNAs that regulate UBE2Z (see all 54):
    hsa-miR-579 hsa-miR-142-5p hsa-miR-4291 hsa-miR-607 hsa-miR-25 hsa-miR-200a hsa-miR-219-5p hsa-miR-764
    SwitchGear 3'UTR luciferase reporter plasmidUBE2Z 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for UBE2Z (see all 7)
    OriGene shRNA RFP: UBE2Z
    OriGene siRNA: UBE2Z
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2Z
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2Z (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2Z (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: UBE2Z (NM_023079)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2Z
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2Z 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for UBE2Z
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat UBE2Z
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2Z
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2Z

    Additional cDNA sequence: 

    AB025426.1 AK023917.1 AK024030.1 AK091644.1 AK122770.1 AK130303.1 AK296865.1 AL713782.1 
    BC015169.1 BC015890.1 CR457322.1 EF623992.1 

    22 DOTS entries:

    DT.456081  DT.101966986  DT.100826843  DT.97851377  DT.99957834  DT.100826844  DT.120911283  DT.120911314 
    DT.120911417  DT.75149705  DT.91759275  DT.91759295  DT.95223440  DT.101984794  DT.102844558  DT.120911414 
    DT.120911425  DT.75101708  DT.91759293  DT.100649701  DT.219192  DT.99942923 

    24/436 AceView cDNA sequences (see all 436):

    BQ130583 BE730712 BQ223253 AL037894 AI038037 BI757130 AW071453 AA100619 
    AW150598 BQ029546 BM272571 CF541264 CA952898 BM803464 AA445998 AA380540 
    BX417998 CB138049 AW956964 AI280694 AK122770 BQ268857 BM550791 BM450804 

    GeneLoc Exon Structure

    5 Alternative Splicing Database (ASD) splice patterns (SP) for UBE2Z    About this scheme

    ExUns: 1 ^ 2a · 2b · 2c ^ 3a · 3b ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7a · 7b
    SP1:        -     -           -           -                                       
    SP2:                          -     -     -                                       
    SP3:                                      -                                       
    SP4:                                                                              
    SP5:                          -           -                                       


    ECgene alternative splicing isoforms for UBE2Z

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    UBE2Z expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: TCTGGCATAG

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See UBE2Z Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for UBE2Z

    SOURCE GeneReport for Unigene cluster: Hs.514297

    UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis

        SABiosciences Expression via Pathway-Focused PCR Array including UBE2Z: 
              Ubiquitination (Ubiquitylation) Pathway in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for UBE2Z
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat UBE2Z
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2Z
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2Z
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2Z

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for UBE2Z gene from 5/20 species (see all 20)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves UBE2Z1 ubiquitin-conjugating enzyme E2Z 78.91(n)
    81.05(a)
      419991  XM_418113.3  XP_418113.1 
    lizard
    (Anolis carolinensis)
    Reptilia UBE2Z6
    --
    --
    72(a)
    1(a)
    1 ↔ 1
    possible ortholog
    6(75952159-75969979)
    1(231934564-232074217)
    African clawed frog
    (Xenopus laevis)
    Amphibia MGC691552 hypothetical protein MGC69155 79.33(n)    BC059343.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.288572 Transcribed sequence with moderate similarity to protein refNP_075567.1 (H.sapiens) hypothetical protein FLJ13855 [Homo sapiens] less 77.78(n)    CF999866.1 
    worm
    (Caenorhabditis elegans)
    Secernentea ubc-176
    Probable ubiquitin-conjugating enzyme protein 17
    10(a)
    1 ↔ 1
    X(7050584-7055330)


    ENSEMBL Gene Tree for UBE2Z (if available)
    TreeFam Gene Tree for UBE2Z (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for UBE2Z gene
    UBE2B2  UBE2S2  UBE2O2  BIRC62  UBE2A2  
    15 SIMAP similar genes for UBE2Z using alignment to 7 protein entries:     UBE2Z_HUMAN (see all proteins):
    UBE2D3    UBE2D4    HR6A    UBE2D2    UBE2O    UBE2N
    UBE2DNL    UBE2D1    BIRC6    UBE2B    UBE2T    UBE2G2
    UBE2NL    UBE2A    UBE2S

    UBE2Z for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/367 NCBI SNPs in UBE2Z are shown (see all 367    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 17 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs286354661,2
    C,F,--46983820(+) CCTGCG/ATGACA 1 -- us2k19Minor allele frequency- A:0.27NA WA EA 370
    rs2015663981,2
    --46983887(+) GACTC-/TTTTTT 1 -- us2k10--------
    rs99021311,2
    C,F,A,--46984042(+) CCGGCT/AAATTT 1 -- us2k12Minor allele frequency- A:0.50NA 4
    rs348997721,2
    C,F,H,--46984425(+) TGAGAC/TGGAGT 1 -- us2k14Minor allele frequency- T:0.08NS NA 678
    rs1837007301,2
    --46984584(+) TTTTTA/GGTAGA 1 -- us2k10--------
    rs562366201,2
    C,--46984832(+) TGCAAC/ACTCCG 1 -- us2k11Minor allele frequency- A:0.00NA 2
    rs558193561,2
    C,--46984859(+) GATCCT/ACCTGC 1 -- us2k11Minor allele frequency- A:0.00NA 2
    rs1880172911,2
    --46984958(+) GTTAGA/GCTGGT 1 -- us2k10--------
    rs1132122621,2
    C,--46985088(+) AGAATC/TCTCAG 1 -- us2k10--------
    rs1807844881,2
    --46985094(+) CTCAGC/GGTTTA 1 -- us2k10--------

    HapMap Linkage Disequilibrium report for UBE2Z (46985731 - 47006422 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 1 variation for UBE2Z
         1 CNV: 0208

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing UBE2Z
    DNA2.0 Custom Variant and Variant Library Synthesis for UBE2Z

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    UBE2Z for disorders           About GeneDecksing

    OMIM gene information: 611362    OMIM disorders: --

    1 disease for UBE2Z:    About MalaCards
    gigantism

    Human Genome Epidemiology (HuGE) Navigator: UBE2Z (1 document)

    Export disorders for UBE2Z gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for UBE2Z gene, integrated from 9 sources (see all 25):
    (articles sorted by number of sources associating them with UBE2Z)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Dual E1 activation systems for ubiquitin differentially regulate E2 enzyme charging. (PubMed id 17597759)1, 2, 3 Jin J.... Harper J.W. (2007)
    2. Cloning and characterization of a gene encoding the human putative ubiquitin conjugating enzyme E2Z (UBE2Z). (PubMed id 17160626)1, 2, 9 Gu X.... Mao Y. (2007)
    3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    5. A census of human soluble protein complexes. (PubMed id 22939629)1 Havugimana P.C....Emili A. (2012)
    6. Protein phosphatase 1a interacting proteins in the hum an brain. (PubMed id 22321011)1 Esteves S.L....da Cruz e Silva E.F. (2012)
    7. Mechanistic studies on activation of ubiquitin and di- ubiquitin-like protein, FAT10, by ubiquitin-like modifier activating enzyme 6, U ba6. (PubMed id 22427669)1 Gavin J.M....Dick L.R. (2012)
    8. Alternative ubiquitin activation/conjugation cascades interact with N-end rule ubiquitin ligases to control degradation of RGS prote ins. (PubMed id 21816346)1 Lee P.C....Harper J.W. (2011)
    9. Large-scale association analysis identifies 13 new su sceptibility loci for coronary artery disease. (PubMed id 21378990)1 Schunkert H....Samani N.J. (2011)
    10. Initial characterization of the human central proteome. (PubMed id 21269460)2 Burkard T.R.... Colinge J. (2011)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 65264 HGNC: 25847 AceView: FLJ13855 Ensembl:ENSG00000159202 euGenes: HUgn65264
    ECgene: UBE2Z Kegg: 65264 H-InvDB: UBE2Z

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for UBE2Z Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for UBE2Z gene:
    Search GeneIP for patents involving UBE2Z

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Recombinant/Natural Proteins for UBE2Z (Use1/UBE2Z)  
     Browse OriGene Antibodies   OriGene shRNA RFP for UBE2Z  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for UBE2Z   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for UBE2Z  
     OriGene Protein Over-expression Lysate for UBE2Z   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for UBE2Z   OriGene 3'-UTR Clone for UBE2Z  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2Z   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2Z  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for UBE2Z   OriGene Custom Protein Services for UBE2Z  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat UBE2Z
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing UBE2Z
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat UBE2Z
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2Z
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2Z
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2Z
     GenScript Custom Purified and Recombinant Proteins Services for UBE2Z GenScript cDNA clones with any tag delivered in your preferred vector for UBE2Z
     GenScript Custom Assay Services for UBE2Z GenScript Custom Superior Antibodies Services for UBE2Z
     GenScript Custom overexpressing Cell Line Services for UBE2Z CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in UBE2Z promoter
     Search Chromatin IP Primers for UBE2Z
     RT2 qPCR Primer Assay in human, mouse, rat UBE2Z
     Search GNC Networks for UBE2Z
     SABiosciences PCR Arrays including human, mouse, rat UBE2Z
     Search Tocris compounds for UBE2Z
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     UBE2Z antibodies
     UBE2Z proteins
     UBE2Z lysates
     Search for Antibodies for UBE2Z at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for UBE2Z
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     UBE2Z Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for UBE2Z
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2Z
     SwitchGear 3'UTR luciferase reporter plasmids for UBE2Z
     SwitchGear Promoter luciferase reporter plasmids for UBE2Z
     Search ThermoFisher Antibodies for UBE2Z
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2Z
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 27 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      UBE2Z gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4