Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



UBE2Z Gene

protein-coding   GIFtS: 61
GCID: GC17P046985

Ubiquitin-Conjugating Enzyme E2Z

  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
Ubiquitin-Conjugating Enzyme E2Z1 2     EC 6.3.2.193 8
UBA6-Specific Enzyme E21 2     USE12
Uba6-Specific E2 Conjugating Enzyme 12 3     Ubiquitin-Conjugating Enzyme E2 Z2
Ubiquitin Carrier Protein Z2 3     Use13
Ubiquitin-Protein Ligase Z2 3     

External Ids:    HGNC: 258471   Entrez Gene: 652642   Ensembl: ENSG000001592027   OMIM: 6113625   UniProtKB: Q9H8323   

Export aliases for UBE2Z gene to outside databases

Previous GC identifers: GC17P044341 GC17P042357


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

Entrez Gene summary for UBE2Z Gene:
This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.
(provided by RefSeq, Feb 2012)

GeneCards Summary for UBE2Z Gene:
UBE2Z (ubiquitin-conjugating enzyme E2Z) is a protein-coding gene. Diseases associated with UBE2Z include gigantism, and coronary artery disease. GO annotations related to this gene include ubiquitin-protein ligase activity. An important paralog of this gene is UBE2O.

UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
Function: Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for
UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence:
NC_000017.11  NC_018928.2  NT_010783.16  
Regulatory elements:
   Regulatory transcription factor binding sites in the UBE2Z gene promoter:
         GR   Pax-5   Bach2   RREB-1   Evi-1   PPAR-alpha   HSF2   Chx10   ARP-1   Ik-1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidUBE2Z promoter sequence
   Search Chromatin IP Primers for UBE2Z

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat UBE2Z


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 17q21.32   Ensembl cytogenetic band:  17q21.32   HGNC cytogenetic band: 17q21.32

UBE2Z Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
UBE2Z gene location

GeneLoc information about chromosome 17         GeneLoc Exon Structure

GeneLoc location for GC17P046985:  view genomic region     (about GC identifiers)

Start:
46,985,731 bp from pter      End:
47,006,422 bp from pter
Size:
20,692 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832 (See protein sequence)
Recommended Name: Ubiquitin-conjugating enzyme E2 Z  
Size: 354 amino acids; 38210 Da
Sequence caution: Sequence=AAH15890.1; Type=Erroneous initiation; Sequence=BAB14724.1; Type=Erroneous initiation;
Secondary accessions: A6N8M6 A6NC60 Q7L354 Q8TCM4 Q9H893
Alternative splicing: 2 isoforms:  Q9H832-1   Q9H832-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for UBE2Z: NX_Q9H832

Explore proteomics data for UBE2Z at MOPED

Post-translational modifications: 

  • Ubiquitination2 at Lys166
  • Modification sites at PhosphoSitePlus
  • 4 DME Specific Peptides for UBE2Z (Q9H832)
     MQDPFGEKRGHFDYQSLL  GDSKNYNECIRHETIRVAVC  SSVLISIQSLMTENPYHNEPGFEQERH  FRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLS 


    See UBE2Z Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins: NP_075567.2  
    ENSEMBL proteins: 
     ENSP00000354201   ENSP00000424543   ENSP00000425398   ENSP00000461147   ENSP00000460759  
     ENSP00000459473  
    Reactome Protein details: Q9H832

    UBE2Z Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    R&D Systems Recombinant & Natural Proteins for UBE2Z (Use1/UBE2Z)
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate for UBE2Z
    OriGene Custom MassSpec
    OriGene Custom Protein Services for UBE2Z
    GenScript Custom Purified and Recombinant Proteins Services for UBE2Z
    Novus Biologicals UBE2Z Proteins
    Novus Biologicals UBE2Z Lysates
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for UBE2Z

    UBE2Z Antibody Products:

    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    R&D Systems Antibodies for UBE2Z (Use1/UBE2Z)
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for UBE2Z
    Novus Biologicals UBE2Z Antibodies
    Abcam antibodies for UBE2Z
    Cloud-Clone Corp. Antibodies for UBE2Z
    Search ThermoFisher Antibodies for UBE2Z
    LSBio Antibodies in human, mouse, rat for UBE2Z

    UBE2Z Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for UBE2Z
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for UBE2Z
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for UBE2Z
    Cloud-Clone Corp. CLIAs for UBE2Z


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    HGNC Gene Families:
    UBE2: Ubiquitin-conjugating enzymes E2

    2 InterPro protein domains:
     IPR000608 UBQ-conjugat_E2
     IPR016135 UBQ-conjugating_enzyme/RWD

    Graphical View of Domain Structure for InterPro Entry Q9H832

    ProtoNet protein and cluster: Q9H832

    1 Blocks protein domain: IPB000608 Ubiquitin-conjugating enzymes

    UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Similarity: Belongs to the ubiquitin-conjugating enzyme family


    UBE2Z for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: UBE2Z_HUMAN, Q9H832
    Function: Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for
    UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation
    Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine

         Enzyme Number (IUBMB): EC 6.3.2.191 2

         Gene Ontology (GO): 4 molecular function terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004842ubiquitin-protein ligase activity IEA--
    GO:0005515protein binding IPI--
    GO:0005524ATP binding IEA--
    GO:0016881acid-amino acid ligase activity ----
         
    UBE2Z for ontologies           About GeneDecksing


    Phenotypes:
         3 GenomeRNAi human phenotypes for UBE2Z:
     Increased cell death HMECs cel  Synthetic lethal with Ras  Wnt reporter downregulated 

    Animal Models:
       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for UBE2Z
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for UBE2Z

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for UBE2Z
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for UBE2Z

    miRNA
    Products:
        
    miRTarBase miRNAs that target UBE2Z:
    hsa-mir-324-3p (MIRT043005), hsa-mir-10b-5p (MIRT047448), hsa-mir-193b-3p (MIRT041495), hsa-mir-484 (MIRT042328), hsa-mir-183-5p (MIRT047039), hsa-mir-196a-5p (MIRT048167), hsa-mir-10a-5p (MIRT047613), hsa-mir-16-5p (MIRT051172), hsa-mir-340-5p (MIRT019617), hsa-mir-32-5p (MIRT028379)

    Block miRNA regulation of human, mouse, rat UBE2Z using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate UBE2Z (see all 54):
    hsa-miR-579 hsa-miR-142-5p hsa-miR-4291 hsa-miR-607 hsa-miR-25 hsa-miR-200a hsa-miR-219-5p hsa-miR-764
    SwitchGear 3'UTR luciferase reporter plasmidUBE2Z 3' UTR sequence
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for UBE2Z
    Predesigned siRNA for gene silencing in human, mouse, rat UBE2Z

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for UBE2Z

    Clone
    Products:
         
    OriGene clones in human, mouse for UBE2Z (see all 9)
    OriGene ORF clones in mouse, rat for UBE2Z
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: UBE2Z (NM_023079)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2Z
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2Z

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for UBE2Z
    Browse ESI BIO Cell Lines and PureStem Progenitors for UBE2Z 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2Z


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from UniProtKB/Swiss-Prot
    UBE2Z_HUMAN, Q9H832: Cytoplasm. Nucleus
    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    nucleus5
    cytosol3
    extracellular1
    peroxisome1
    plasma membrane1

    Gene Ontology (GO): 3 cellular component terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005634nucleus IDA--
    GO:0005730NOT nucleolus IDA--
    GO:0005737cytoplasm IDA--

    UBE2Z for ontologies           About GeneDecksing


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus

    SuperPaths for UBE2Z About    
    See pathways by source

    SuperPathContained pathways About
    1Class I MHC mediated antigen processing and presentation
    Class I MHC mediated antigen processing and presentation0.84
    Adaptive Immune System0.41
    Antigen processing- Ubiquitination and Proteasome degradation0.84
    Ubiquitin mediated proteolysis0.35

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways


    1 Reactome Pathway for UBE2Z
        Antigen processing: Ubiquitination & Proteasome degradation


    1 Kegg Pathway  (Kegg details for UBE2Z):
        Ubiquitin mediated proteolysis

    UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Pathway: Protein modification; protein ubiquitination


    UBE2Z for pathways           About GeneDecksing

        Pathway & Disease-focused RT2 Profiler PCR Array including UBE2Z: 

              Ubiquitination (Ubiquitylation) Pathway in human mouse rat

    Interactions:

        Search GeneGlobe Interaction Network for UBE2Z

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    Selected Interacting proteins for UBE2Z (Q9H8322, 3 ENSP000003542014) via UniProtKB, MINT, STRING, and/or I2D (see all 55)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    PLEKHF2Q9H8W42, 3, ENSP000003223734MINT-67937 I2D: score=5 STRING: ENSP00000322373
    LPLP068582, 3MINT-63417 I2D: score=5 
    RNF5Q999423, ENSP000003642354I2D: score=2 STRING: ENSP00000364235
    ENSG00000183574Q999423I2D: score=2 
    ENSG00000223767Q999423I2D: score=2 
    About this table

    Gene Ontology (GO): 1 biological process term:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006915apoptotic process IEA--

    UBE2Z for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Browse Tocris compounds for UBE2Z

    4 HMDB Compounds for UBE2Z    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosine monophosphate5'-AMP (see all 28)61-19-8--
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, and/or QIAGEN )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for UBE2Z gene: 
    NM_023079.4  

    Unigene Cluster for UBE2Z:

    Ubiquitin-conjugating enzyme E2Z
    Hs.514297  [show with all ESTs]
    Unigene Representative Sequence: AK091644
    8 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000360943(uc002ioi.3) ENST00000508468 ENST00000506498 ENST00000511373
    ENST00000504684 ENST00000513342 ENST00000506271 ENST00000514948
    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat UBE2Z using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate UBE2Z (see all 54):
    hsa-miR-579 hsa-miR-142-5p hsa-miR-4291 hsa-miR-607 hsa-miR-25 hsa-miR-200a hsa-miR-219-5p hsa-miR-764
    SwitchGear 3'UTR luciferase reporter plasmidUBE2Z 3' UTR sequence
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for UBE2Z
    Predesigned siRNA for gene silencing in human, mouse, rat UBE2Z
    Clone
    Products:
         
    OriGene clones in human, mouse for UBE2Z (see all 9)
    OriGene ORF clones in mouse, rat for UBE2Z
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: UBE2Z (NM_023079)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2Z
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2Z
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for UBE2Z
    OriGene qSTAR qPCR primer pairs in human, mouse for UBE2Z
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat UBE2Z
      QuantiTect SYBR Green Assays in human, mouse, rat UBE2Z
      QuantiFast Probe-based Assays in human, mouse, rat UBE2Z

    Additional mRNA sequence: 

    AB025426.1 AK023917.1 AK024030.1 AK091644.1 AK122770.1 AK130303.1 AK296865.1 AL713782.1 
    BC015169.1 BC015890.1 CR457322.1 EF623992.1 

    22 DOTS entries:

    DT.101966986  DT.456081  DT.100826843  DT.97851377  DT.99957834  DT.100826844  DT.120911283  DT.120911314 
    DT.120911417  DT.75149705  DT.91759275  DT.91759295  DT.95223440  DT.101984794  DT.102844558  DT.120911414 
    DT.120911425  DT.75101708  DT.91759293  DT.100649701  DT.219192  DT.99942923 

    Selected AceView cDNA sequences (see all 436):

    AW071453 AI669613 AW028385 BQ268857 CA417956 BG222810 BU621347 AI200213 
    AL121008 AW103048 CA422112 BX417998 AI979044 BG402867 BU627737 CD518800 
    AA843379 AL582446 AA357716 AW166392 CB321809 BU528162 CB139704 BM272571 

    GeneLoc Exon Structure

    5 Alternative Splicing Database (ASD) splice patterns (SP) for UBE2Z    About this scheme

    ExUns: 1 ^ 2a · 2b · 2c ^ 3a · 3b ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7a · 7b
    SP1:        -     -           -           -                                       
    SP2:                          -     -     -                                       
    SP3:                                      -                                       
    SP4:                                                                              
    SP5:                          -           -                                       


    ECgene alternative splicing isoforms for UBE2Z

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    UBE2Z expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TCTGGCATAG
    UBE2Z Expression
    About this image

    UBE2Z Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    UBE2Z Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.514297

    UniProtKB/Swiss-Prot: UBE2Z_HUMAN, Q9H832
    Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis

        Pathway & Disease-focused RT2 Profiler PCR Array including UBE2Z: 
              Ubiquitination (Ubiquitylation) Pathway in human mouse rat

    Primer
    Products:
    OriGene qPCR primer pairs and template standards for UBE2Z
    OriGene qSTAR qPCR primer pairs in human, mouse for UBE2Z
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat UBE2Z
    QuantiTect SYBR Green Assays in human, mouse, rat UBE2Z
    QuantiFast Probe-based Assays in human, mouse, rat UBE2Z
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2Z

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of chordates.

    Orthologs for UBE2Z gene from Selected species (see all 13)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Ube2z1 , 5 ubiquitin-conjugating enzyme E2Z (putative)1, 5 93.22(n)1
    98.31(a)1
      11 (59.28 cM)5
    2684701  NM_172300.31  NP_758504.31 
     960474325 
    chicken
    (Gallus gallus)
    Aves UBE2Z1 ubiquitin-conjugating enzyme E2Z 82.28(n)
    86.97(a)
      419991  XM_418113.4  XP_418113.1 
    lizard
    (Anolis carolinensis)
    Reptilia UBE2Z6
    ubiquitin-conjugating enzyme E2Z
    78(a)
    1 ↔ 1
    6(75952159-75969979)
    African clawed frog
    (Xenopus laevis)
    Amphibia MGC691552 hypothetical protein MGC69155 79.33(n)    BC059343.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.288572 Transcribed sequence with moderate similarity to protein more 77.78(n)    CF999866.1 


    ENSEMBL Gene Tree for UBE2Z (if available)
    TreeFam Gene Tree for UBE2Z (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for UBE2Z gene
    UBE2O2  BIRC62  
    12 SIMAP similar genes for UBE2Z using alignment to 7 protein entries:     UBE2Z_HUMAN (see all proteins):
    UBE2D3    UBE2D4    HR6A    UBE2D2    UBE2O    UBE2N
    UBE2DNL    UBE2D1    BIRC6    UBE2B    UBE2T    UBE2G2

    UBE2Z for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for UBE2Z (see all 442)    About this table    
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 17 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs286354661,2
    C,F--46983820(+) CCTGCG/ATGACA 1 -- us2k19Minor allele frequency- A:0.27NA WA EA 370
    rs2015663981,2
    --46983887(+) GACTC-/TTTTTT 1 -- us2k10--------
    rs99021311,2
    C,F,A--46984042(+) ccggcT/Aaattt 1 -- us2k12Minor allele frequency- A:0.50NA 4
    rs348997721,2
    C,F,H--46984425(+) TGAGAC/TGGAGT 1 -- us2k14Minor allele frequency- T:0.08NS NA 678
    rs1837007301,2
    C--46984584(+) TTTTTA/GGTAGA 1 -- us2k10--------
    rs562366201,2
    C--46984832(+) TGCAAC/ACTCCG 1 -- us2k11Minor allele frequency- A:0.00NA 2
    rs558193561,2
    C--46984859(+) GATCCT/ACCTGC 1 -- us2k11Minor allele frequency- A:0.00NA 2
    rs1880172911,2
    --46984958(+) GTTAGA/GCTGGT 1 -- us2k10--------
    rs1132122621,2
    C,F--46985088(+) AGAATC/TCTCAG 1 -- us2k10--------
    rs1807844881,2
    --46985094(+) CTCAGC/GGTTTA 1 -- us2k10--------

    HapMap Linkage Disequilibrium report for UBE2Z (46985731 - 47006422 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 3 variations for UBE2Z:    About this table    
    Variant IDTypeSubtypePubMed ID
    nsv2073CNV Insertion18451855
    nsv482969CNV Loss15286789
    nsv833472CNV Gain17160897

    Site Specific Mutation Identification with PCR Assays
    SeqTarget long-range PCR primers for resequencing UBE2Z
    DNA2.0 Custom Variant and Variant Library Synthesis for UBE2Z

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 611362    OMIM disorders: --

    2 diseases for UBE2Z:    
    About MalaCards
    gigantism    coronary artery disease


    UBE2Z for disorders           About GeneDecksing

    Genetic Association Database (GAD): UBE2Z
    Human Genome Epidemiology (HuGE) Navigator: UBE2Z (1 document)

    Export disorders for UBE2Z gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for UBE2Z gene, integrated from 10 sources (see all 30):
    (articles sorted by number of sources associating them with UBE2Z)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Dual E1 activation systems for ubiquitin differentially regulate E2 enzyme charging. (PubMed id 17597759)1, 2, 3 Jin J.... Harper J.W. (Nature 2007)
    2. Cloning and characterization of a gene encoding the human putative ubiquitin conjugating enzyme E2Z (UBE2Z). (PubMed id 17160626)1, 2, 9 Gu X.... Mao Y. (Mol. Biol. Rep. 2007)
    3. Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease. (PubMed id 21378990)1, 4 Schunkert H....Samani N.J. (Nat. Genet. 2011)
    4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S.... Malek J. (Genome Res. 2004)
    5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (Nat. Genet. 2004)
    6. Bcl2-associated athanogene 3 interactome analysis reveals a new role in modulating proteasome activity. (PubMed id 23824909)1 Chen Y....Ge F. (amp 2013)
    7. Proteome-wide identification of ubiquitylation sites by conjugation of engineered lysine-less ubiquitin. (PubMed id 22053931)1 Oshikawa K....Nakayama K.I. (J. Proteome Res. 2012)
    8. A census of human soluble protein complexes. (PubMed id 22939629)1 Havugimana P.C....Emili A. (Cell 2012)
    9. Protein phosphatase 1I+ interacting proteins in the human brain. (PubMed id 22321011)1 Esteves S.L....da Cruz e Silva E.F. (OMICS 2012)
    10. Systems-wide analysis of ubiquitylation dynamics reveals a key role for PAF15 ubiquitylation in DNA-damage bypass. (PubMed id 23000965)1 Povlsen L.K....Choudhary C. (Nat. Cell Biol. 2012)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 65264 HGNC: 25847 AceView: FLJ13855 Ensembl:ENSG00000159202 euGenes: HUgn65264
    ECgene: UBE2Z Kegg: 65264 H-InvDB: UBE2Z

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for UBE2Z Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for UBE2Z gene:
    Search GeneIP for patents involving UBE2Z

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript, and ESI BIO, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     
     EMD Millipore genomic analysis products

      
     Antibodies for UBE2Z (Use1/UBE2Z)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Recombinant/Natural Proteins for UBE2Z (Use1/UBE2Z)   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for UBE2Z  
     OriGene qPCR primer pairs and template standards for UBE2Z   OriGene Protein Over-expression Lysate for UBE2Z  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for UBE2Z  
     OriGene qSTAR qPCR primer pairs in human, mouse for UBE2Z   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for UBE2Z   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for UBE2Z   OriGene Custom Protein Services for UBE2Z  

     
     
     Block miRNA regulation of human, mouse, rat UBE2Z using miScript Target Protectors SeqTarget long-range PCR primers for resequencing UBE2Z
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat UBE2Z Predesigned siRNA for gene silencing in human, mouse, rat UBE2Z
     QuantiFast Probe-based Assays in human, mouse, rat UBE2Z QuantiTect SYBR Green Assays in human, mouse, rat UBE2Z
     PCR Arrays including human, mouse, rat UBE2Z Search Chromatin IP Primers for UBE2Z
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat UBE2Z  Search GeneGlobe Interaction Network for UBE2Z
     Regulatory tfbs in UBE2Z promoter
     GenScript Custom Purified and Recombinant Proteins Services for UBE2Z GenScript cDNA clones with any tag delivered in your preferred vector for UBE2Z
     GenScript Custom Assay Services for UBE2Z GenScript Custom overexpressing Cell Line Services for UBE2Z
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Search for Antibodies & Assays

     Search Tocris compounds for UBE2Z
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     UBE2Z antibodies
     UBE2Z proteins
     UBE2Z lysates
     Antibodies for UBE2Z
     See all of Abcam's Antibodies, Kits and Proteins for UBE2Z
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins
     Proteins for UBE2Z
     Antibodies for UBE2Z
     ELISAs for UBE2Z
     CLIAs for UBE2Z



     Browse ESI BIO Cell Lines and PureStem Progenitors for UBE2Z
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2Z
     SwitchGear 3'UTR luciferase reporter plasmids for UBE2Z
     SwitchGear Promoter luciferase reporter plasmids for UBE2Z
     Search ThermoFisher Antibodies for UBE2Z
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2Z
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for UBE2Z
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for UBE2Z
     LSBio Antibodies in human, mouse, rat for UBE2Z
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      UBE2Z gene at Home site.
    Version: 3.12.142 28 July 2014
    hostname: 356977-web1.xennexinc.com index build: 126 solr: 1.4